Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 161 (11 Dec 2019)
Sequence version 2 (07 Jun 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Regulator of G-protein signaling 3

Gene

Rgs3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Down-regulates signaling from heterotrimeric G-proteins by increasing the GTPase activity of the alpha subunits, thereby driving them into their inactive GDP-bound form. Down-regulates G-protein-mediated release of inositol phosphates and activation of MAP kinases.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionSignal transduction inhibitor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-416476 G alpha (q) signalling events
R-MMU-418594 G alpha (i) signalling events

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Regulator of G-protein signaling 3
Short name:
RGS3
Alternative name(s):
C2PA
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Rgs3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1354734 Rgs3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002041831 – 966Regulator of G-protein signaling 3Add BLAST966

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei167Omega-N-methylarginineBy similarity1
Modified residuei712PhosphoserineCombined sources1
Modified residuei715PhosphoserineCombined sources1
Modified residuei747PhosphoserineCombined sources1
Modified residuei776PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by cyclic GMP-dependent protein kinase.By similarity
ISGylated.By similarity

Keywords - PTMi

Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9DC04

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9DC04

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9DC04

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9DC04

PeptideAtlas

More...
PeptideAtlasi
Q9DC04

PRoteomics IDEntifications database

More...
PRIDEi
Q9DC04

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9DC04

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9DC04

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in embryos from E8.5-16.5 in cortical ventricular zone, dorsal root ganglia and cerebellar primordia. Isoform 3 is detected in testis and in spermatocytes from newborn mice. Levels increase and reach a maximum after 21 days; after this they decrease again. Long isoforms are widely expressed.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000059810 Expressed in 174 organ(s), highest expression level in brown adipose tissue

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9DC04 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9DC04 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds the GNB1-GNG2 heterodimer (By similarity). Binds EFNB1 and EFNB2.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
206112, 2 interactors

Protein interaction database and analysis system

More...
IntActi
Q9DC04, 1 interactor

Molecular INTeraction database

More...
MINTi
Q9DC04

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000081569

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9DC04 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1966
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9DC04

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9DC04

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini18 – 95PDZPROSITE-ProRule annotationAdd BLAST78
Domaini841 – 966RGSPROSITE-ProRule annotationAdd BLAST126

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi417 – 574Pro-richAdd BLAST158

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3589 Eukaryota
ENOG410YMJD LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154416

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9DC04

KEGG Orthology (KO)

More...
KOi
K07524

Database of Orthologous Groups

More...
OrthoDBi
201302at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9DC04

TreeFam database of animal gene trees

More...
TreeFami
TF351952

Family and domain databases

Conserved Domains Database

More...
CDDi
cd08713 RGS_RGS3, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.196.10, 2 hits
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001478 PDZ
IPR041489 PDZ_6
IPR036034 PDZ_sf
IPR011993 PH-like_dom_sf
IPR016137 RGS
IPR034951 RGS_RGS3
IPR036305 RGS_sf
IPR024066 RGS_subdom1/3

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF17820 PDZ_6, 1 hit
PF00615 RGS, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01301 RGSPROTEIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00228 PDZ, 1 hit
SM00315 RGS, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48097 SSF48097, 1 hit
SSF50156 SSF50156, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50106 PDZ, 1 hit
PS50132 RGS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9DC04-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNRFNGLCKV CSERRYRQIT IRRGKDGFGF TICCDSPVRV QAVDSGGPAE
60 70 80 90 100
RAGLQQLDTV LQLNERPVEH WKCVELAHEI RSCPSEIILL VWRVVPQIKP
110 120 130 140 150
GPDGGVLRRA SCKSTHDLLS PPNKREKNCT HGAPVRPEQR HSCHLVCDSS
160 170 180 190 200
DGLLLGGWER YTEVGKRSGQ HTLPALSRTT TPTDPNYIIL APLNPGSQLL
210 220 230 240 250
RPVYQEDTIP EEPGTTTKGK SYTGLGKKSR LMKTVQTMKG HSNYQDCSAL
260 270 280 290 300
RPHIPHSSYG TYVTLAPKVL VFPVFVQPLD LCNPARTLLL SEELLLYEGR
310 320 330 340 350
NKTSQVTLFA YSDLLLFTKE EEPGRCDVLR NPLYLQSVKL QEGSSEDLKF
360 370 380 390 400
CVLYLAEKAE CLFTLEAHSQ EQKKRVCWCL SENIAKQQQL AAPPTERKMF
410 420 430 440 450
ETEADEKEMP LVEGKGPGAE EPAPSKNPSP GQELPPGQDL PPSKDPSPSQ
460 470 480 490 500
ELPAGQDLPP SKDPSPSQEL PAGQDLPPSK DPSPSQELPV GQDLPPRKDS
510 520 530 540 550
SGQEAAPGPE SPSSEDIATC PKPPQSPETS TSKDSPPGQG SSPTTELPSC
560 570 580 590 600
QGLPAGQEST SQDPLLSQEP PVIPESSASV QKRLPSQESP SSLGSLPEKD
610 620 630 640 650
LAEQTISSGE PPVATGAVLP ASRPNFVIPE VRLDNAYSQL DGAHGGSSGE
660 670 680 690 700
DEDAEEGEEG GEGEEDEEDD TSDDNYGDRS EAKRSSLIET GQGAEGGFSL
710 720 730 740 750
RVQNSLRRRT HSEGSLLQES RGPCFASDTT LHCSDGEGAT STWAIPSPRT
760 770 780 790 800
LKKELGRNGG SMHHLSLFFT GHRKMSGTDL TECDEASRKR KSKNIAKDMK
810 820 830 840 850
NKLAIFRRRN ESPGAQPASK TDKTTKSFKP TSEEALKWSE SLEKLLLHKY
860 870 880 890 900
GLEVFQAFLR TEFSEENLEF WLACEDFKKV KSQSKMAAKA KKIFAEFIAI
910 920 930 940 950
QACKEVNLDS YTREHTKENL QSITRGCFDL AQKRIFGLME KDSYPRFLRS
960
DLYLDLINQK KMSPPL
Length:966
Mass (Da):106,219
Last modified:June 7, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i20B6B2BB7A9C8BB2
GO
Isoform 5 (identifier: Q9DC04-1) [UniParc]FASTAAdd to basket
Also known as: Long

The sequence of this isoform differs from the canonical sequence as follows:
     1-398: Missing.

Show »
Length:568
Mass (Da):61,559
Checksum:i91939E22F3DA9F5C
GO
Isoform 6 (identifier: Q9DC04-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     399-773: Missing.
     774-795: KMSGTDLTECDEASRKRKSKNI → MLRGMYLTRNGNLQRRHTMKE

Show »
Length:590
Mass (Da):67,161
Checksum:iED8AACB256F455BA
GO
Isoform 2 (identifier: Q9DC04-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     455-490: Missing.

Show »
Length:930
Mass (Da):102,501
Checksum:i0D407C93459F3B7F
GO
Isoform 3 (identifier: Q9DC04-5) [UniParc]FASTAAdd to basket
Also known as: C2PA

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: MNRFNGLCKVCSERRYR → MERPHQDASL...EGDPENGEKL
     399-433: MFETEADEKEMPLVEGKGPGAEEPAPSKNPSPGQE → KLHPYGSLQQEMGPVTSISATQDRSFTSSGQTLIG
     434-966: Missing.

Note: Nuclear.1 Publication
Show »
Length:610
Mass (Da):68,468
Checksum:iDAD60727CD56056F
GO
Isoform 4 (identifier: Q9DC04-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     399-433: MFETEADEKEMPLVEGKGPGAEEPAPSKNPSPGQE → KLHPYGSLQQEMGPVTSISATQDRSFTSSGQTLIG
     434-966: Missing.

Show »
Length:433
Mass (Da):48,383
Checksum:i1347D9311876B525
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
I7HPB2I7HPB2_MOUSE
Regulator of G-protein-signaling 3
Rgs3
602Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I7HFV2I7HFV2_MOUSE
Regulator of G-protein-signaling 3
Rgs3
261Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I7HJI7I7HJI7_MOUSE
Regulator of G-protein-signaling 3
Rgs3
108Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q542M0Q542M0_MOUSE
Regulator of G-protein-signaling 3
Rgs3
192Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6X4A2F6X4A2_MOUSE
Regulator of G-protein-signaling 3
Rgs3
126Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Z4YJQ4Z4YJQ4_MOUSE
Regulator of G-protein-signaling 3
Rgs3
610Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti179T → A in AAL37173 (Ref. 3) Curated1
Sequence conflicti501S → P in AAK38878 (PubMed:11034339).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0139661 – 398Missing in isoform 5. 2 PublicationsAdd BLAST398
Alternative sequenceiVSP_0139671 – 17MNRFN…ERRYR → MERPHQDASLSKKDACTQTY PPRRRIRHAQVQDAGQLKLS IDAQDRVLLPHIIEGKGLMS REPGICDPYVKVSLIPEDSQ LPCQTTQIIPDCRDPAFHEH FFFPVPEEGDQKRLLVTVWN RASETRQHTLIGCMSFGVRS LLTPDKEISGWYYLLGEDLG RTKHLKVARRRLQPLRDMLL RMPGEGDPENGEKL in isoform 3. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_005663399 – 773Missing in isoform 6. CuratedAdd BLAST375
Alternative sequenceiVSP_013968399 – 433MFETE…SPGQE → KLHPYGSLQQEMGPVTSISA TQDRSFTSSGQTLIG in isoform 3 and isoform 4. 3 PublicationsAdd BLAST35
Alternative sequenceiVSP_013969434 – 966Missing in isoform 3 and isoform 4. 3 PublicationsAdd BLAST533
Alternative sequenceiVSP_013970455 – 490Missing in isoform 2. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_005664774 – 795KMSGT…KSKNI → MLRGMYLTRNGNLQRRHTMK E in isoform 6. CuratedAdd BLAST22

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ250999 mRNA Translation: CAB66146.1
AF350047 mRNA Translation: AAK38878.1
AF319519 mRNA Translation: AAL37173.1
AK004648 mRNA Translation: BAB23439.1
AK028445 mRNA Translation: BAC25954.1
AL672272 Genomic DNA No translation available.
BC033449 mRNA Translation: AAH33449.1
AF215670 mRNA Translation: AAF34627.1
AF215669 mRNA Translation: AAF34626.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS18246.1 [Q9DC04-5]
CCDS38776.1 [Q9DC04-6]
CCDS51202.1 [Q9DC04-3]
CCDS80110.1 [Q9DC04-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001075119.1, NM_001081650.2 [Q9DC04-6]
NP_001297635.1, NM_001310706.1 [Q9DC04-1]
NP_062365.2, NM_019492.3
NP_599018.3, NM_134257.3 [Q9DC04-3]
XP_006538130.1, XM_006538067.3
XP_006538131.1, XM_006538068.3 [Q9DC04-1]
XP_006538132.1, XM_006538069.3 [Q9DC04-1]
XP_006538133.1, XM_006538070.3 [Q9DC04-1]
XP_017175797.1, XM_017320308.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000084521; ENSMUSP00000081569; ENSMUSG00000059810 [Q9DC04-3]
ENSMUST00000107420; ENSMUSP00000103043; ENSMUSG00000059810 [Q9DC04-1]
ENSMUST00000107424; ENSMUSP00000103047; ENSMUSG00000059810 [Q9DC04-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
50780

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:50780

UCSC genome browser

More...
UCSCi
uc008tfe.2 mouse [Q9DC04-6]
uc008tfg.1 mouse [Q9DC04-1]
uc008tfh.2 mouse [Q9DC04-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ250999 mRNA Translation: CAB66146.1
AF350047 mRNA Translation: AAK38878.1
AF319519 mRNA Translation: AAL37173.1
AK004648 mRNA Translation: BAB23439.1
AK028445 mRNA Translation: BAC25954.1
AL672272 Genomic DNA No translation available.
BC033449 mRNA Translation: AAH33449.1
AF215670 mRNA Translation: AAF34627.1
AF215669 mRNA Translation: AAF34626.1
CCDSiCCDS18246.1 [Q9DC04-5]
CCDS38776.1 [Q9DC04-6]
CCDS51202.1 [Q9DC04-3]
CCDS80110.1 [Q9DC04-1]
RefSeqiNP_001075119.1, NM_001081650.2 [Q9DC04-6]
NP_001297635.1, NM_001310706.1 [Q9DC04-1]
NP_062365.2, NM_019492.3
NP_599018.3, NM_134257.3 [Q9DC04-3]
XP_006538130.1, XM_006538067.3
XP_006538131.1, XM_006538068.3 [Q9DC04-1]
XP_006538132.1, XM_006538069.3 [Q9DC04-1]
XP_006538133.1, XM_006538070.3 [Q9DC04-1]
XP_017175797.1, XM_017320308.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WHDNMR-A18-94[»]
SMRiQ9DC04
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi206112, 2 interactors
IntActiQ9DC04, 1 interactor
MINTiQ9DC04
STRINGi10090.ENSMUSP00000081569

PTM databases

iPTMnetiQ9DC04
PhosphoSitePlusiQ9DC04

Proteomic databases

EPDiQ9DC04
jPOSTiQ9DC04
MaxQBiQ9DC04
PaxDbiQ9DC04
PeptideAtlasiQ9DC04
PRIDEiQ9DC04

Genome annotation databases

EnsembliENSMUST00000084521; ENSMUSP00000081569; ENSMUSG00000059810 [Q9DC04-3]
ENSMUST00000107420; ENSMUSP00000103043; ENSMUSG00000059810 [Q9DC04-1]
ENSMUST00000107424; ENSMUSP00000103047; ENSMUSG00000059810 [Q9DC04-6]
GeneIDi50780
KEGGimmu:50780
UCSCiuc008tfe.2 mouse [Q9DC04-6]
uc008tfg.1 mouse [Q9DC04-1]
uc008tfh.2 mouse [Q9DC04-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5998
MGIiMGI:1354734 Rgs3

Phylogenomic databases

eggNOGiKOG3589 Eukaryota
ENOG410YMJD LUCA
GeneTreeiENSGT00940000154416
InParanoidiQ9DC04
KOiK07524
OrthoDBi201302at2759
PhylomeDBiQ9DC04
TreeFamiTF351952

Enzyme and pathway databases

ReactomeiR-MMU-416476 G alpha (q) signalling events
R-MMU-418594 G alpha (i) signalling events

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Rgs3 mouse
EvolutionaryTraceiQ9DC04

Protein Ontology

More...
PROi
PR:Q9DC04
RNActiQ9DC04 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000059810 Expressed in 174 organ(s), highest expression level in brown adipose tissue
ExpressionAtlasiQ9DC04 baseline and differential
GenevisibleiQ9DC04 MM

Family and domain databases

CDDicd08713 RGS_RGS3, 1 hit
Gene3Di1.10.196.10, 2 hits
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR001478 PDZ
IPR041489 PDZ_6
IPR036034 PDZ_sf
IPR011993 PH-like_dom_sf
IPR016137 RGS
IPR034951 RGS_RGS3
IPR036305 RGS_sf
IPR024066 RGS_subdom1/3
PfamiView protein in Pfam
PF17820 PDZ_6, 1 hit
PF00615 RGS, 1 hit
PRINTSiPR01301 RGSPROTEIN
SMARTiView protein in SMART
SM00228 PDZ, 1 hit
SM00315 RGS, 1 hit
SUPFAMiSSF48097 SSF48097, 1 hit
SSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS50106 PDZ, 1 hit
PS50132 RGS, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRGS3_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9DC04
Secondary accession number(s): Q5SRB1
, Q5SRB4, Q5SRB8, Q8CEE3, Q8VI25, Q925G9, Q9JL22, Q9JL23, Q9QXA2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 14, 2001
Last sequence update: June 7, 2005
Last modified: December 11, 2019
This is version 161 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again