Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Minor histocompatibility antigen H13

Gene

Hm13

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein, resulting in the release of the fragment from the ER membrane into the cytoplasm. Required to generate lymphocyte cell surface (HLA-E) epitopes derived from MHC class I signal peptides. Involved in the intramembrane cleavage of the integral membrane protein PSEN1. Cleaves the integral membrane protein XBP1 isoform 1 in a DERL1/RNF139-dependent manner (By similarity). May play a role in graft rejection (PubMed:9354467).By similarity1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei219By similarity1
Active sitei265By similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionHydrolase, Protease

Protein family/group databases

MEROPSiA22.003

Names & Taxonomyi

Protein namesi
Recommended name:
Minor histocompatibility antigen H13 (EC:3.4.23.-)
Alternative name(s):
Presenilin-like protein 3
Signal peptide peptidase
Gene namesi
Name:Hm13
Synonyms:H13, Psl3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:95886 H13

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 31LumenalBy similarityAdd BLAST31
Transmembranei32 – 52HelicalSequence analysisAdd BLAST21
Topological domaini53 – 77CytoplasmicSequence analysisAdd BLAST25
Transmembranei78 – 98HelicalSequence analysisAdd BLAST21
Topological domaini99 – 100LumenalSequence analysis2
Transmembranei101 – 121HelicalSequence analysisAdd BLAST21
Topological domaini122 – 157CytoplasmicSequence analysisAdd BLAST36
Transmembranei158 – 178HelicalSequence analysisAdd BLAST21
Topological domaini179 – 181LumenalSequence analysis3
Transmembranei182 – 202HelicalSequence analysisAdd BLAST21
Topological domaini203 – 209CytoplasmicSequence analysis7
Transmembranei210 – 230HelicalSequence analysisAdd BLAST21
Topological domaini231 – 256LumenalBy similarityAdd BLAST26
Transmembranei257 – 277HelicalSequence analysisAdd BLAST21
Topological domaini278 – 290CytoplasmicSequence analysisAdd BLAST13
Transmembranei291 – 311HelicalSequence analysisAdd BLAST21
Topological domaini312 – 314LumenalSequence analysis3
Transmembranei315 – 335HelicalSequence analysisAdd BLAST21
Topological domaini336 – 378CytoplasmicBy similarityAdd BLAST43

Keywords - Cellular componenti

Cell membrane, Endoplasmic reticulum, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000739081 – 378Minor histocompatibility antigen H13Add BLAST378

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi10N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi20N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei368PhosphoserineBy similarity1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

EPDiQ9D8V0
PeptideAtlasiQ9D8V0
PRIDEiQ9D8V0

PTM databases

iPTMnetiQ9D8V0
PhosphoSitePlusiQ9D8V0
SwissPalmiQ9D8V0

Expressioni

Tissue specificityi

Widely expressed with highest levels in liver and kidney. In the brain, expressed predominantly in hippocampus, amygdala, piriform cortex, choroid plexus and arcuate nucleus of the hypothalamic area. Isoform 1 is more strongly expressed than isoform 4 in most tissues except brain and skeletal muscle where isoform 4 is the dominant isoform and in testis where isoform 1 and isoform 4 are expressed at similar levels. In the brain, isoform 4 is not detected in the choroid plexus.2 Publications

Developmental stagei

In the embryo, expression starts at day 6.5.1 Publication

Gene expression databases

BgeeiENSMUSG00000019188 Expressed in 308 organ(s), highest expression level in seminal vesicle
CleanExiMM_H13
ExpressionAtlasiQ9D8V0 baseline and differential
GenevisibleiQ9D8V0 MM

Interactioni

Subunit structurei

Monomer. Homodimer (By similarity). Interacts with RNF139 (PubMed:19720873). Interacts with DERL1 and XBP1 isoform 1 (By similarity).By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi200142, 1 interactor

Structurei

3D structure databases

ProteinModelPortaliQ9D8V0
SMRiQ9D8V0
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9D8V0

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi317 – 319PAL3

Domaini

The first transmembrane domain may act as a type I signal anchor. The PAL motif is required for normal active site conformation.By similarity

Sequence similaritiesi

Belongs to the peptidase A22B family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00530000062920
HOVERGENiHBG024161
InParanoidiQ9D8V0
KOiK09595
OMAiHLNNVVT
OrthoDBiEOG091G0AWL
PhylomeDBiQ9D8V0
TreeFamiTF105854

Family and domain databases

InterProiView protein in InterPro
IPR007369 Peptidase_A22B_SPP
IPR006639 Preselin/SPP
PANTHERiPTHR12174 PTHR12174, 1 hit
PfamiView protein in Pfam
PF04258 Peptidase_A22B, 1 hit
SMARTiView protein in SMART
SM00730 PSN, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9D8V0-1) [UniParc]FASTAAdd to basket
Also known as: SPP-alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDSAVSDPHN GSAEAGTPAN GTTRPPSTPE GIALAYGSLL LMALLPIFFG
60 70 80 90 100
ALRSVRCARG KSSSDMPETI TSRDAARFPI IASCTLLGLY LFFKIFSQEY
110 120 130 140 150
INLLLSMYFF VLGILALSHT ISPFMNKFFP ANFPNRQYQL LFTQGSGENK
160 170 180 190 200
EEIINYEFDT KDLVCLGLSS VVGVWYLLRK HWIANNLFGL AFSLNGVELL
210 220 230 240 250
HLNNVSTGCI LLGGLFIYDI FWVFGTNVMV TVAKSFEAPI KLVFPQDLLE
260 270 280 290 300
KGLEADNFAM LGLGDIVIPG IFIALLLRFD ISLKKNTHTY FYTSFAAYIF
310 320 330 340 350
GLGLTIFIMH IFKHAQPALL YLVPACIGFP VLVALAKGEV AEMFSYEESN
360 370
PKDPAAETES KEESTEASAS KRLEKKEK
Length:378
Mass (Da):41,748
Last modified:June 1, 2001 - v1
Checksum:iFB3B047323239A0D
GO
Isoform 2 (identifier: Q9D8V0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     122-173: SPFMNKFFPA...VCLGLSSVVG → RSEGISRQPL...GNLPSRQHYT
     174-378: Missing.

Note: No experimental confirmation available.
Show »
Length:173
Mass (Da):18,706
Checksum:iA8592DD6E82FAA37
GO
Isoform 3 (identifier: Q9D8V0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     119-151: HTISPFMNKFFPANFPNRQYQLLFTQGSGENKE → DDADSHALLQALTGWGWGGSLTLGSELIWPLCP
     181-193: HWIANNLFGLAFS → VSQSLRRRGGWAD

Show »
Length:378
Mass (Da):41,337
Checksum:iF6D4E61F39AC507C
GO
Isoform 4 (identifier: Q9D8V0-4) [UniParc]FASTAAdd to basket
Also known as: SPP-beta

The sequence of this isoform differs from the canonical sequence as follows:
     348-378: ESNPKDPAAETESKEESTEASASKRLEKKEK → SSAVILPHTP...RRRPQNPSAM

Show »
Length:394
Mass (Da):43,364
Checksum:i50072422E73F4D0F
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q6PGJ8Q6PGJ8_MOUSE
H13 protein
H13 mCG_3727
224Annotation score:
A3KGR9A3KGR9_MOUSE
Histocompatibility 13
H13
347Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti42M → T in ABA56162 (PubMed:16730383).Curated1
Sequence conflicti53R → P in CAC87793 (Ref. 3) Curated1
Sequence conflicti53R → P in AAM22075 (Ref. 4) Curated1
Sequence conflicti73R → Q in AAM22077 (Ref. 4) Curated1
Sequence conflicti172V → I in AAN77098 (PubMed:12972007).Curated1
Sequence conflicti172V → I in AAM22077 (Ref. 4) Curated1
Sequence conflicti172V → I in BAE34875 (PubMed:16141072).Curated1
Sequence conflicti294S → E in BAC25752 (PubMed:16141072).Curated1
Sequence conflicti357E → V in AAN77098 (PubMed:12972007).Curated1
Sequence conflicti357E → V in CAC87793 (Ref. 3) Curated1
Sequence conflicti357E → V in AAM22075 (Ref. 4) Curated1
Sequence conflicti357E → V in BAE34875 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_005201119 – 151HTISP…GENKE → DDADSHALLQALTGWGWGGS LTLGSELIWPLCP in isoform 3. CuratedAdd BLAST33
Alternative sequenceiVSP_005199122 – 173SPFMN…SSVVG → RSEGISRQPLKLLSQEPVQG LGWEHGLLCHSEPGLNPGCK IQGNLPSRQHYT in isoform 2. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_005200174 – 378Missing in isoform 2. 1 PublicationAdd BLAST205
Alternative sequenceiVSP_005202181 – 193HWIAN…GLAFS → VSQSLRRRGGWAD in isoform 3. CuratedAdd BLAST13
Alternative sequenceiVSP_039805348 – 378ESNPK…EKKEK → SSAVILPHTPRLTHFPTVSG SPASLADSMQQKLAGPRRRR PQNPSAM in isoform 4. 1 PublicationAdd BLAST31

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF515662 mRNA Translation: AAN77098.1
DQ168449 mRNA Translation: ABA56162.1
AJ345032 mRNA Translation: CAC87793.1
AF483214 mRNA Translation: AAM22075.1
AF483216 Genomic DNA Translation: AAM22077.1
AK004690 mRNA Translation: BAB23476.1
AK007664 mRNA Translation: BAB25172.1
AK012600 mRNA No translation available.
AK019877 mRNA Translation: BAB31897.1
AK028109 mRNA Translation: BAC25752.1
AK049101 mRNA Translation: BAC33543.1
AK050664 mRNA Translation: BAC34369.1
AK080966 mRNA Translation: BAC38098.1
AK159176 mRNA Translation: BAE34875.1
AK169922 mRNA Translation: BAE41461.1
AL845162 Genomic DNA Translation: CAM46159.1
AL845162 Genomic DNA Translation: CAM46160.1
CH466551 Genomic DNA Translation: EDL05980.1
CH466551 Genomic DNA Translation: EDL05981.1
AF017785 mRNA Translation: AAB81863.1
BC034217 mRNA No translation available.
CCDSiCCDS16896.1 [Q9D8V0-1]
CCDS50752.1 [Q9D8V0-4]
RefSeqiNP_001153023.1, NM_001159551.1 [Q9D8V0-4]
NP_001153025.1, NM_001159553.1 [Q9D8V0-2]
NP_034506.1, NM_010376.4 [Q9D8V0-1]
UniGeneiMm.277327

Genome annotation databases

EnsembliENSMUST00000089059; ENSMUSP00000086460; ENSMUSG00000019188 [Q9D8V0-4]
ENSMUST00000125366; ENSMUSP00000120068; ENSMUSG00000019188 [Q9D8V0-1]
GeneIDi14950
KEGGimmu:14950
UCSCiuc008nfz.2 mouse [Q9D8V0-2]
uc008ngb.2 mouse [Q9D8V0-1]
uc008ngc.2 mouse [Q9D8V0-4]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF515662 mRNA Translation: AAN77098.1
DQ168449 mRNA Translation: ABA56162.1
AJ345032 mRNA Translation: CAC87793.1
AF483214 mRNA Translation: AAM22075.1
AF483216 Genomic DNA Translation: AAM22077.1
AK004690 mRNA Translation: BAB23476.1
AK007664 mRNA Translation: BAB25172.1
AK012600 mRNA No translation available.
AK019877 mRNA Translation: BAB31897.1
AK028109 mRNA Translation: BAC25752.1
AK049101 mRNA Translation: BAC33543.1
AK050664 mRNA Translation: BAC34369.1
AK080966 mRNA Translation: BAC38098.1
AK159176 mRNA Translation: BAE34875.1
AK169922 mRNA Translation: BAE41461.1
AL845162 Genomic DNA Translation: CAM46159.1
AL845162 Genomic DNA Translation: CAM46160.1
CH466551 Genomic DNA Translation: EDL05980.1
CH466551 Genomic DNA Translation: EDL05981.1
AF017785 mRNA Translation: AAB81863.1
BC034217 mRNA No translation available.
CCDSiCCDS16896.1 [Q9D8V0-1]
CCDS50752.1 [Q9D8V0-4]
RefSeqiNP_001153023.1, NM_001159551.1 [Q9D8V0-4]
NP_001153025.1, NM_001159553.1 [Q9D8V0-2]
NP_034506.1, NM_010376.4 [Q9D8V0-1]
UniGeneiMm.277327

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1INQX-ray2.20C169-177[»]
1JUFX-ray2.00C169-177[»]
ProteinModelPortaliQ9D8V0
SMRiQ9D8V0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi200142, 1 interactor

Protein family/group databases

MEROPSiA22.003

PTM databases

iPTMnetiQ9D8V0
PhosphoSitePlusiQ9D8V0
SwissPalmiQ9D8V0

Proteomic databases

EPDiQ9D8V0
PeptideAtlasiQ9D8V0
PRIDEiQ9D8V0

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000089059; ENSMUSP00000086460; ENSMUSG00000019188 [Q9D8V0-4]
ENSMUST00000125366; ENSMUSP00000120068; ENSMUSG00000019188 [Q9D8V0-1]
GeneIDi14950
KEGGimmu:14950
UCSCiuc008nfz.2 mouse [Q9D8V0-2]
uc008ngb.2 mouse [Q9D8V0-1]
uc008ngc.2 mouse [Q9D8V0-4]

Organism-specific databases

CTDi14950
MGIiMGI:95886 H13

Phylogenomic databases

GeneTreeiENSGT00530000062920
HOVERGENiHBG024161
InParanoidiQ9D8V0
KOiK09595
OMAiHLNNVVT
OrthoDBiEOG091G0AWL
PhylomeDBiQ9D8V0
TreeFamiTF105854

Miscellaneous databases

ChiTaRSiH13 mouse
EvolutionaryTraceiQ9D8V0
PROiPR:Q9D8V0
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000019188 Expressed in 308 organ(s), highest expression level in seminal vesicle
CleanExiMM_H13
ExpressionAtlasiQ9D8V0 baseline and differential
GenevisibleiQ9D8V0 MM

Family and domain databases

InterProiView protein in InterPro
IPR007369 Peptidase_A22B_SPP
IPR006639 Preselin/SPP
PANTHERiPTHR12174 PTHR12174, 1 hit
PfamiView protein in Pfam
PF04258 Peptidase_A22B, 1 hit
SMARTiView protein in SMART
SM00730 PSN, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiHM13_MOUSE
AccessioniPrimary (citable) accession number: Q9D8V0
Secondary accession number(s): A3KGS1
, O19444, Q15K37, Q3TXP0, Q542R3, Q811Z6, Q8HWA9, Q8HWB5, Q9CQA4, Q9CSK9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 8, 2002
Last sequence update: June 1, 2001
Last modified: November 7, 2018
This is version 150 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again