Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 155 (08 May 2019)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Minor histocompatibility antigen H13

Gene

Hm13

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein, resulting in the release of the fragment from the ER membrane into the cytoplasm. Required to generate lymphocyte cell surface (HLA-E) epitopes derived from MHC class I signal peptides. Involved in the intramembrane cleavage of the integral membrane protein PSEN1. Cleaves the integral membrane protein XBP1 isoform 1 in a DERL1/RNF139-dependent manner (By similarity). May play a role in graft rejection (PubMed:9354467).By similarity1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei219By similarity1
Active sitei265By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protease

Protein family/group databases

MEROPS protease database

More...
MEROPSi
A22.003

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Minor histocompatibility antigen H13 (EC:3.4.23.-)
Alternative name(s):
Presenilin-like protein 3
Signal peptide peptidase
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Hm13
Synonyms:H13, Psl3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:95886 H13

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 31LumenalBy similarityAdd BLAST31
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei32 – 52HelicalSequence analysisAdd BLAST21
Topological domaini53 – 77CytoplasmicSequence analysisAdd BLAST25
Transmembranei78 – 98HelicalSequence analysisAdd BLAST21
Topological domaini99 – 100LumenalSequence analysis2
Transmembranei101 – 121HelicalSequence analysisAdd BLAST21
Topological domaini122 – 157CytoplasmicSequence analysisAdd BLAST36
Transmembranei158 – 178HelicalSequence analysisAdd BLAST21
Topological domaini179 – 181LumenalSequence analysis3
Transmembranei182 – 202HelicalSequence analysisAdd BLAST21
Topological domaini203 – 209CytoplasmicSequence analysis7
Transmembranei210 – 230HelicalSequence analysisAdd BLAST21
Topological domaini231 – 256LumenalBy similarityAdd BLAST26
Transmembranei257 – 277HelicalSequence analysisAdd BLAST21
Topological domaini278 – 290CytoplasmicSequence analysisAdd BLAST13
Transmembranei291 – 311HelicalSequence analysisAdd BLAST21
Topological domaini312 – 314LumenalSequence analysis3
Transmembranei315 – 335HelicalSequence analysisAdd BLAST21
Topological domaini336 – 378CytoplasmicBy similarityAdd BLAST43

Keywords - Cellular componenti

Cell membrane, Endoplasmic reticulum, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000739081 – 378Minor histocompatibility antigen H13Add BLAST378

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi10N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi20N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei368PhosphoserineBy similarity1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9D8V0

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9D8V0

PeptideAtlas

More...
PeptideAtlasi
Q9D8V0

PRoteomics IDEntifications database

More...
PRIDEi
Q9D8V0

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9D8V0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9D8V0

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9D8V0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed with highest levels in liver and kidney. In the brain, expressed predominantly in hippocampus, amygdala, piriform cortex, choroid plexus and arcuate nucleus of the hypothalamic area. Isoform 1 is more strongly expressed than isoform 4 in most tissues except brain and skeletal muscle where isoform 4 is the dominant isoform and in testis where isoform 1 and isoform 4 are expressed at similar levels. In the brain, isoform 4 is not detected in the choroid plexus.2 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

In the embryo, expression starts at day 6.5.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000019188 Expressed in 308 organ(s), highest expression level in seminal vesicle

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9D8V0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9D8V0 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer. Homodimer (By similarity). Interacts with RNF139 (PubMed:19720873). Interacts with DERL1 and XBP1 isoform 1 (By similarity).By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
200142, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000086460

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9D8V0

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9D8V0

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi317 – 319PAL3

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The first transmembrane domain may act as a type I signal anchor. The PAL motif is required for normal active site conformation.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase A22B family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156478

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9D8V0

KEGG Orthology (KO)

More...
KOi
K09595

Identification of Orthologs from Complete Genome Data

More...
OMAi
HLNNVVT

Database of Orthologous Groups

More...
OrthoDBi
1087991at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9D8V0

TreeFam database of animal gene trees

More...
TreeFami
TF105854

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007369 Peptidase_A22B_SPP
IPR006639 Preselin/SPP

The PANTHER Classification System

More...
PANTHERi
PTHR12174 PTHR12174, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04258 Peptidase_A22B, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00730 PSN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9D8V0-1) [UniParc]FASTAAdd to basket
Also known as: SPP-alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDSAVSDPHN GSAEAGTPAN GTTRPPSTPE GIALAYGSLL LMALLPIFFG
60 70 80 90 100
ALRSVRCARG KSSSDMPETI TSRDAARFPI IASCTLLGLY LFFKIFSQEY
110 120 130 140 150
INLLLSMYFF VLGILALSHT ISPFMNKFFP ANFPNRQYQL LFTQGSGENK
160 170 180 190 200
EEIINYEFDT KDLVCLGLSS VVGVWYLLRK HWIANNLFGL AFSLNGVELL
210 220 230 240 250
HLNNVSTGCI LLGGLFIYDI FWVFGTNVMV TVAKSFEAPI KLVFPQDLLE
260 270 280 290 300
KGLEADNFAM LGLGDIVIPG IFIALLLRFD ISLKKNTHTY FYTSFAAYIF
310 320 330 340 350
GLGLTIFIMH IFKHAQPALL YLVPACIGFP VLVALAKGEV AEMFSYEESN
360 370
PKDPAAETES KEESTEASAS KRLEKKEK
Length:378
Mass (Da):41,748
Last modified:June 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFB3B047323239A0D
GO
Isoform 2 (identifier: Q9D8V0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     122-173: SPFMNKFFPA...VCLGLSSVVG → RSEGISRQPL...GNLPSRQHYT
     174-378: Missing.

Note: No experimental confirmation available.
Show »
Length:173
Mass (Da):18,706
Checksum:iA8592DD6E82FAA37
GO
Isoform 3 (identifier: Q9D8V0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     119-151: HTISPFMNKFFPANFPNRQYQLLFTQGSGENKE → DDADSHALLQALTGWGWGGSLTLGSELIWPLCP
     181-193: HWIANNLFGLAFS → VSQSLRRRGGWAD

Show »
Length:378
Mass (Da):41,337
Checksum:iF6D4E61F39AC507C
GO
Isoform 4 (identifier: Q9D8V0-4) [UniParc]FASTAAdd to basket
Also known as: SPP-beta

The sequence of this isoform differs from the canonical sequence as follows:
     348-378: ESNPKDPAAETESKEESTEASASKRLEKKEK → SSAVILPHTP...RRRPQNPSAM

Show »
Length:394
Mass (Da):43,364
Checksum:i50072422E73F4D0F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A3KGR9A3KGR9_MOUSE
Histocompatibility 13
H13
347Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q6PGJ8Q6PGJ8_MOUSE
H13 protein
H13 mCG_3727
224Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti42M → T in ABA56162 (PubMed:16730383).Curated1
Sequence conflicti53R → P in CAC87793 (Ref. 3) Curated1
Sequence conflicti53R → P in AAM22075 (Ref. 4) Curated1
Sequence conflicti73R → Q in AAM22077 (Ref. 4) Curated1
Sequence conflicti172V → I in AAN77098 (PubMed:12972007).Curated1
Sequence conflicti172V → I in AAM22077 (Ref. 4) Curated1
Sequence conflicti172V → I in BAE34875 (PubMed:16141072).Curated1
Sequence conflicti294S → E in BAC25752 (PubMed:16141072).Curated1
Sequence conflicti357E → V in AAN77098 (PubMed:12972007).Curated1
Sequence conflicti357E → V in CAC87793 (Ref. 3) Curated1
Sequence conflicti357E → V in AAM22075 (Ref. 4) Curated1
Sequence conflicti357E → V in BAE34875 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_005201119 – 151HTISP…GENKE → DDADSHALLQALTGWGWGGS LTLGSELIWPLCP in isoform 3. CuratedAdd BLAST33
Alternative sequenceiVSP_005199122 – 173SPFMN…SSVVG → RSEGISRQPLKLLSQEPVQG LGWEHGLLCHSEPGLNPGCK IQGNLPSRQHYT in isoform 2. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_005200174 – 378Missing in isoform 2. 1 PublicationAdd BLAST205
Alternative sequenceiVSP_005202181 – 193HWIAN…GLAFS → VSQSLRRRGGWAD in isoform 3. CuratedAdd BLAST13
Alternative sequenceiVSP_039805348 – 378ESNPK…EKKEK → SSAVILPHTPRLTHFPTVSG SPASLADSMQQKLAGPRRRR PQNPSAM in isoform 4. 1 PublicationAdd BLAST31

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF515662 mRNA Translation: AAN77098.1
DQ168449 mRNA Translation: ABA56162.1
AJ345032 mRNA Translation: CAC87793.1
AF483214 mRNA Translation: AAM22075.1
AF483216 Genomic DNA Translation: AAM22077.1
AK004690 mRNA Translation: BAB23476.1
AK007664 mRNA Translation: BAB25172.1
AK012600 mRNA No translation available.
AK019877 mRNA Translation: BAB31897.1
AK028109 mRNA Translation: BAC25752.1
AK049101 mRNA Translation: BAC33543.1
AK050664 mRNA Translation: BAC34369.1
AK080966 mRNA Translation: BAC38098.1
AK159176 mRNA Translation: BAE34875.1
AK169922 mRNA Translation: BAE41461.1
AL845162 Genomic DNA No translation available.
CH466551 Genomic DNA Translation: EDL05980.1
CH466551 Genomic DNA Translation: EDL05981.1
AF017785 mRNA Translation: AAB81863.1
BC034217 mRNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS16896.1 [Q9D8V0-1]
CCDS50752.1 [Q9D8V0-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001153023.1, NM_001159551.1 [Q9D8V0-4]
NP_001153025.1, NM_001159553.1 [Q9D8V0-2]
NP_034506.1, NM_010376.4 [Q9D8V0-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000089059; ENSMUSP00000086460; ENSMUSG00000019188 [Q9D8V0-4]
ENSMUST00000125366; ENSMUSP00000120068; ENSMUSG00000019188 [Q9D8V0-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
14950

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:14950

UCSC genome browser

More...
UCSCi
uc008nfz.2 mouse [Q9D8V0-2]
uc008ngb.2 mouse [Q9D8V0-1]
uc008ngc.2 mouse [Q9D8V0-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF515662 mRNA Translation: AAN77098.1
DQ168449 mRNA Translation: ABA56162.1
AJ345032 mRNA Translation: CAC87793.1
AF483214 mRNA Translation: AAM22075.1
AF483216 Genomic DNA Translation: AAM22077.1
AK004690 mRNA Translation: BAB23476.1
AK007664 mRNA Translation: BAB25172.1
AK012600 mRNA No translation available.
AK019877 mRNA Translation: BAB31897.1
AK028109 mRNA Translation: BAC25752.1
AK049101 mRNA Translation: BAC33543.1
AK050664 mRNA Translation: BAC34369.1
AK080966 mRNA Translation: BAC38098.1
AK159176 mRNA Translation: BAE34875.1
AK169922 mRNA Translation: BAE41461.1
AL845162 Genomic DNA No translation available.
CH466551 Genomic DNA Translation: EDL05980.1
CH466551 Genomic DNA Translation: EDL05981.1
AF017785 mRNA Translation: AAB81863.1
BC034217 mRNA No translation available.
CCDSiCCDS16896.1 [Q9D8V0-1]
CCDS50752.1 [Q9D8V0-4]
RefSeqiNP_001153023.1, NM_001159551.1 [Q9D8V0-4]
NP_001153025.1, NM_001159553.1 [Q9D8V0-2]
NP_034506.1, NM_010376.4 [Q9D8V0-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1INQX-ray2.20C169-177[»]
1JUFX-ray2.00C169-177[»]
SMRiQ9D8V0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi200142, 1 interactor
STRINGi10090.ENSMUSP00000086460

Protein family/group databases

MEROPSiA22.003

PTM databases

iPTMnetiQ9D8V0
PhosphoSitePlusiQ9D8V0
SwissPalmiQ9D8V0

Proteomic databases

EPDiQ9D8V0
jPOSTiQ9D8V0
PeptideAtlasiQ9D8V0
PRIDEiQ9D8V0

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000089059; ENSMUSP00000086460; ENSMUSG00000019188 [Q9D8V0-4]
ENSMUST00000125366; ENSMUSP00000120068; ENSMUSG00000019188 [Q9D8V0-1]
GeneIDi14950
KEGGimmu:14950
UCSCiuc008nfz.2 mouse [Q9D8V0-2]
uc008ngb.2 mouse [Q9D8V0-1]
uc008ngc.2 mouse [Q9D8V0-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
14950
MGIiMGI:95886 H13

Phylogenomic databases

GeneTreeiENSGT00940000156478
InParanoidiQ9D8V0
KOiK09595
OMAiHLNNVVT
OrthoDBi1087991at2759
PhylomeDBiQ9D8V0
TreeFamiTF105854

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
H13 mouse
EvolutionaryTraceiQ9D8V0

Protein Ontology

More...
PROi
PR:Q9D8V0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000019188 Expressed in 308 organ(s), highest expression level in seminal vesicle
ExpressionAtlasiQ9D8V0 baseline and differential
GenevisibleiQ9D8V0 MM

Family and domain databases

InterProiView protein in InterPro
IPR007369 Peptidase_A22B_SPP
IPR006639 Preselin/SPP
PANTHERiPTHR12174 PTHR12174, 1 hit
PfamiView protein in Pfam
PF04258 Peptidase_A22B, 1 hit
SMARTiView protein in SMART
SM00730 PSN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHM13_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9D8V0
Secondary accession number(s): A3KGS1
, O19444, Q15K37, Q3TXP0, Q542R3, Q811Z6, Q8HWA9, Q8HWB5, Q9CQA4, Q9CSK9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 8, 2002
Last sequence update: June 1, 2001
Last modified: May 8, 2019
This is version 155 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Peptidase families
    Classification of peptidase families and list of entries
  4. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again