Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

39S ribosomal protein L17, mitochondrial

Gene

Mrpl17

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

GO - Biological processi

  • mitochondrial genome maintenance Source: MGI
  • translation Source: MGI

Keywordsi

Molecular functionRibonucleoprotein, Ribosomal protein

Enzyme and pathway databases

ReactomeiR-MMU-5389840 Mitochondrial translation elongation
R-MMU-5419276 Mitochondrial translation termination

Names & Taxonomyi

Protein namesi
Recommended name:
39S ribosomal protein L17, mitochondrial
Short name:
L17mt
Short name:
MRP-L17
Gene namesi
Name:Mrpl17
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:1351608 Mrpl17

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Mitochondrion

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transit peptidei1 – 8MitochondrionBy similarity8
ChainiPRO_00002373329 – 17639S ribosomal protein L17, mitochondrialAdd BLAST168

Proteomic databases

EPDiQ9D8P4
PaxDbiQ9D8P4
PeptideAtlasiQ9D8P4
PRIDEiQ9D8P4

PTM databases

iPTMnetiQ9D8P4
PhosphoSitePlusiQ9D8P4

Expressioni

Gene expression databases

BgeeiENSMUSG00000030879 Expressed in 293 organ(s), highest expression level in brown adipose tissue
CleanExiMM_MRPL17
ExpressionAtlasiQ9D8P4 baseline and differential
GenevisibleiQ9D8P4 MM

Interactioni

Subunit structurei

Component of the mitochondrial ribosome large subunit (39S) which comprises a 16S rRNA and about 50 distinct proteins.By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000117971

Structurei

3D structure databases

ProteinModelPortaliQ9D8P4
SMRiQ9D8P4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiKOG3280 Eukaryota
COG0203 LUCA
GeneTreeiENSGT00390000010698
HOGENOMiHOG000019780
HOVERGENiHBG056029
InParanoidiQ9D8P4
KOiK02879
OMAiTMEMADY
OrthoDBiEOG091G0PQG
PhylomeDBiQ9D8P4
TreeFamiTF105844

Family and domain databases

Gene3Di3.90.1030.10, 1 hit
InterProiView protein in InterPro
IPR000456 Ribosomal_L17
IPR036373 Ribosomal_L17_sf
PANTHERiPTHR14413 PTHR14413, 1 hit
PfamiView protein in Pfam
PF01196 Ribosomal_L17, 1 hit
SUPFAMiSSF64263 SSF64263, 1 hit
TIGRFAMsiTIGR00059 L17, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9D8P4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRLSLAAAIS HGRVYRRLGL GPESRIHLLR NLLTGLVRHE RIEATWARAD
60 70 80 90 100
EMRGYAEKLI DYGKLGDTNE RAMRMADFWL TEKDLIPKLF KVLAPRFQGQ
110 120 130 140 150
NGNYTRMLQI PNRKEQDRAK MAVIEYKGNY LPPLPLPHRD SNLTLLNQLL
160 170
LGLQQDLHHN QDASLHSSCT VQTPKT
Length:176
Mass (Da):20,249
Last modified:June 1, 2001 - v1
Checksum:i3A0CBC71740A4E42
GO
Isoform 2 (identifier: Q9D8P4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     82-116: EKDLIPKLFKVLAPRFQGQNGNYTRMLQIPNRKEQ → VSAPYLLVRKESLENRVPGRLKAGHSFMYQTCELP
     117-176: Missing.

Show »
Length:116
Mass (Da):13,340
Checksum:i9627DA824FA17466
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BIZ3H3BIZ3_MOUSE
39S ribosomal protein L17, mitochon...
Mrpl17
111Annotation score:
H3BJT9H3BJT9_MOUSE
39S ribosomal protein L17, mitochon...
Mrpl17
109Annotation score:
A0A1B0GSV1A0A1B0GSV1_MOUSE
39S ribosomal protein L17, mitochon...
Mrpl17
122Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01859082 – 116EKDLI…NRKEQ → VSAPYLLVRKESLENRVPGR LKAGHSFMYQTCELP in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_018591117 – 176Missing in isoform 2. 1 PublicationAdd BLAST60

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK007828 mRNA Translation: BAB25288.1
AK144092 mRNA Translation: BAE25695.1
AK147957 mRNA Translation: BAE28251.1
BC010718 mRNA Translation: AAH10718.1
CCDSiCCDS21662.1 [Q9D8P4-1]
RefSeqiNP_079577.1, NM_025301.2 [Q9D8P4-1]
UniGeneiMm.44225

Genome annotation databases

EnsembliENSMUST00000033170; ENSMUSP00000147523; ENSMUSG00000030879 [Q9D8P4-2]
ENSMUST00000124482; ENSMUSP00000117971; ENSMUSG00000030879 [Q9D8P4-1]
GeneIDi27397
KEGGimmu:27397
UCSCiuc009izl.1 mouse [Q9D8P4-1]
uc009izm.1 mouse [Q9D8P4-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK007828 mRNA Translation: BAB25288.1
AK144092 mRNA Translation: BAE25695.1
AK147957 mRNA Translation: BAE28251.1
BC010718 mRNA Translation: AAH10718.1
CCDSiCCDS21662.1 [Q9D8P4-1]
RefSeqiNP_079577.1, NM_025301.2 [Q9D8P4-1]
UniGeneiMm.44225

3D structure databases

ProteinModelPortaliQ9D8P4
SMRiQ9D8P4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000117971

PTM databases

iPTMnetiQ9D8P4
PhosphoSitePlusiQ9D8P4

Proteomic databases

EPDiQ9D8P4
PaxDbiQ9D8P4
PeptideAtlasiQ9D8P4
PRIDEiQ9D8P4

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000033170; ENSMUSP00000147523; ENSMUSG00000030879 [Q9D8P4-2]
ENSMUST00000124482; ENSMUSP00000117971; ENSMUSG00000030879 [Q9D8P4-1]
GeneIDi27397
KEGGimmu:27397
UCSCiuc009izl.1 mouse [Q9D8P4-1]
uc009izm.1 mouse [Q9D8P4-2]

Organism-specific databases

CTDi63875
MGIiMGI:1351608 Mrpl17

Phylogenomic databases

eggNOGiKOG3280 Eukaryota
COG0203 LUCA
GeneTreeiENSGT00390000010698
HOGENOMiHOG000019780
HOVERGENiHBG056029
InParanoidiQ9D8P4
KOiK02879
OMAiTMEMADY
OrthoDBiEOG091G0PQG
PhylomeDBiQ9D8P4
TreeFamiTF105844

Enzyme and pathway databases

ReactomeiR-MMU-5389840 Mitochondrial translation elongation
R-MMU-5419276 Mitochondrial translation termination

Miscellaneous databases

PROiPR:Q9D8P4
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000030879 Expressed in 293 organ(s), highest expression level in brown adipose tissue
CleanExiMM_MRPL17
ExpressionAtlasiQ9D8P4 baseline and differential
GenevisibleiQ9D8P4 MM

Family and domain databases

Gene3Di3.90.1030.10, 1 hit
InterProiView protein in InterPro
IPR000456 Ribosomal_L17
IPR036373 Ribosomal_L17_sf
PANTHERiPTHR14413 PTHR14413, 1 hit
PfamiView protein in Pfam
PF01196 Ribosomal_L17, 1 hit
SUPFAMiSSF64263 SSF64263, 1 hit
TIGRFAMsiTIGR00059 L17, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRM17_MOUSE
AccessioniPrimary (citable) accession number: Q9D8P4
Secondary accession number(s): Q91VR0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2006
Last sequence update: June 1, 2001
Last modified: November 7, 2018
This is version 119 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Ribosomal proteins
    Ribosomal proteins families and list of entries
  3. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again