Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 128 (08 May 2019)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Mitochondrial peptide methionine sulfoxide reductase

Gene

Msra

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • L-methionine-(S)-S-oxide reductase activity Source: GO_Central
  • peptide-methionine (S)-S-oxide reductase activity Source: MGI

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionOxidoreductase

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
1.8.4.11 3474

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-5676934 Protein repair

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Mitochondrial peptide methionine sulfoxide reductase (EC:1.8.4.11)
Alternative name(s):
Peptide-methionine (S)-S-oxide reductase
Short name:
Peptide Met(O) reductase
Protein-methionine-S-oxide reductase
Short name:
PMSR
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Msra
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:106916 Msra

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Membrane, Mitochondrion, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – 20MitochondrionBy similarityAdd BLAST20
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000013862721 – 233Mitochondrial peptide methionine sulfoxide reductaseAdd BLAST213

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei104N6-acetyllysine; alternateCombined sources1
Modified residuei104N6-succinyllysine; alternateCombined sources1
Modified residuei183N6-acetyllysine; alternateCombined sources1
Modified residuei183N6-succinyllysine; alternateCombined sources1
Isoform 2 (identifier: Q9D6Y7-2)
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi2N-myristoyl glycine1

Keywords - PTMi

Acetylation, Lipoprotein, Myristate

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9D6Y7

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9D6Y7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9D6Y7

PeptideAtlas

More...
PeptideAtlasi
Q9D6Y7

PRoteomics IDEntifications database

More...
PRIDEi
Q9D6Y7

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9D6Y7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9D6Y7

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9D6Y7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000054733 Expressed in 269 organ(s), highest expression level in heart left ventricle

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9D6Y7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9D6Y7 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q9D6Y7, 4 interactors

Molecular INTeraction database

More...
MINTi
Q9D6Y7

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000065754

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1233
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9D6Y7

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transit peptide

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1635 Eukaryota
COG0225 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000003823

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000263862

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9D6Y7

KEGG Orthology (KO)

More...
KOi
K07304

Identification of Orthologs from Complete Genome Data

More...
OMAi
MRQGGDI

Database of Orthologous Groups

More...
OrthoDBi
1383773at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9D6Y7

TreeFam database of animal gene trees

More...
TreeFami
TF353884

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.1060.10, 1 hit

HAMAP database of protein families

More...
HAMAPi
MF_01401 MsrA, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002569 Met_Sox_Rdtase_MsrA
IPR036509 Met_Sox_Rdtase_MsrA_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01625 PMSR, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF55068 SSF55068, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00401 msrA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing and alternative initiation. AlignAdd to basket
Note: Only about 25% of mRNAs are initiated at the mitochondrial isoform 1 codon. According to PubMed:15924425, differential subcellular targeting is not due alternative initiation.1 Publication

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9D6Y7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLSASRRALQ LLSSANPVRR MGDSASKVIS AEEALPGRTE PIPVTAKHHV
60 70 80 90 100
SGNRTVEPFP EGTQMAVFGM GCFWGAERKF WVLKGVYSTQ VGFAGGHTRN
110 120 130 140 150
PTYKEVCSEK TGHAEVVRVV YRPEHISFEE LLKVFWENHD PTQGMRQGND
160 170 180 190 200
FGTQYRSAVY PTSAVQMEAA LRSKEEYQKV LSKHNFGPIT TDIREGQVFY
210 220 230
YAEDYHQQYL SKNPDGYCGL GGTGVSCPMA IKK
Note: Mitochondrial.
Length:233
Mass (Da):25,988
Last modified:June 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB16EFE01BE751242
GO
Isoform 2 (identifier: Q9D6Y7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: Missing.

Note: Cytoplasmic. Produced by alternative initiation.
Show »
Length:213
Mass (Da):23,780
Checksum:i016CA48DFF31A154
GO
Isoform 3 (identifier: Q9D6Y7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-108: Missing.

Show »
Length:193
Mass (Da):21,550
Checksum:iBF6451CEEF2B8C7E
GO
Isoform 4 (identifier: Q9D6Y7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MLSASRRALQLLSSANPVRRMGDSASKVISAEEALPGRTEPIPVT → MSK

Show »
Length:191
Mass (Da):21,588
Checksum:i05A91F2966016833
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1B0GT40A0A1B0GT40_MOUSE
Mitochondrial peptide methionine su...
Msra
169Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti20R → G in BAB22035 (PubMed:16141072).Curated1
Sequence conflicti156R → P in AK018338 (PubMed:16141072).Curated1
Sequence conflicti187G → V in BAB22035 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0414081 – 45MLSAS…PIPVT → MSK in isoform 4. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_0421331 – 20Missing in isoform 2. CuratedAdd BLAST20
Alternative sequenceiVSP_04140969 – 108Missing in isoform 3. 1 PublicationAdd BLAST40

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK002356 mRNA Translation: BAB22035.1
AK009822 mRNA Translation: BAB26522.1
AK049714 mRNA Translation: BAC33889.1
AK018338 mRNA No translation available.
CH466535 Genomic DNA Translation: EDL36048.1
BC014738 mRNA Translation: AAH14738.1
BC089311 mRNA Translation: AAH89311.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS27209.1 [Q9D6Y7-1]
CCDS84147.1 [Q9D6Y7-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001240641.1, NM_001253712.1 [Q9D6Y7-1]
NP_001240643.1, NM_001253714.1
NP_001240644.1, NM_001253715.1 [Q9D6Y7-3]
NP_001240645.1, NM_001253716.1 [Q9D6Y7-4]
NP_080598.2, NM_026322.4 [Q9D6Y7-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000067927; ENSMUSP00000065754; ENSMUSG00000054733 [Q9D6Y7-1]
ENSMUST00000210428; ENSMUSP00000147689; ENSMUSG00000054733 [Q9D6Y7-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
110265

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:110265

UCSC genome browser

More...
UCSCi
uc007uig.2 mouse [Q9D6Y7-4]
uc007uih.2 mouse [Q9D6Y7-3]
uc007uii.2 mouse [Q9D6Y7-1]

Keywords - Coding sequence diversityi

Alternative initiation, Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK002356 mRNA Translation: BAB22035.1
AK009822 mRNA Translation: BAB26522.1
AK049714 mRNA Translation: BAC33889.1
AK018338 mRNA No translation available.
CH466535 Genomic DNA Translation: EDL36048.1
BC014738 mRNA Translation: AAH14738.1
BC089311 mRNA Translation: AAH89311.1
CCDSiCCDS27209.1 [Q9D6Y7-1]
CCDS84147.1 [Q9D6Y7-4]
RefSeqiNP_001240641.1, NM_001253712.1 [Q9D6Y7-1]
NP_001240643.1, NM_001253714.1
NP_001240644.1, NM_001253715.1 [Q9D6Y7-3]
NP_001240645.1, NM_001253716.1 [Q9D6Y7-4]
NP_080598.2, NM_026322.4 [Q9D6Y7-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2L90NMR-A22-233[»]
SMRiQ9D6Y7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ9D6Y7, 4 interactors
MINTiQ9D6Y7
STRINGi10090.ENSMUSP00000065754

PTM databases

iPTMnetiQ9D6Y7
PhosphoSitePlusiQ9D6Y7
SwissPalmiQ9D6Y7

Proteomic databases

EPDiQ9D6Y7
jPOSTiQ9D6Y7
PaxDbiQ9D6Y7
PeptideAtlasiQ9D6Y7
PRIDEiQ9D6Y7

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000067927; ENSMUSP00000065754; ENSMUSG00000054733 [Q9D6Y7-1]
ENSMUST00000210428; ENSMUSP00000147689; ENSMUSG00000054733 [Q9D6Y7-4]
GeneIDi110265
KEGGimmu:110265
UCSCiuc007uig.2 mouse [Q9D6Y7-4]
uc007uih.2 mouse [Q9D6Y7-3]
uc007uii.2 mouse [Q9D6Y7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4482
MGIiMGI:106916 Msra

Phylogenomic databases

eggNOGiKOG1635 Eukaryota
COG0225 LUCA
GeneTreeiENSGT00390000003823
HOGENOMiHOG000263862
InParanoidiQ9D6Y7
KOiK07304
OMAiMRQGGDI
OrthoDBi1383773at2759
PhylomeDBiQ9D6Y7
TreeFamiTF353884

Enzyme and pathway databases

BRENDAi1.8.4.11 3474
ReactomeiR-MMU-5676934 Protein repair

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Msra mouse

Protein Ontology

More...
PROi
PR:Q9D6Y7

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000054733 Expressed in 269 organ(s), highest expression level in heart left ventricle
ExpressionAtlasiQ9D6Y7 baseline and differential
GenevisibleiQ9D6Y7 MM

Family and domain databases

Gene3Di3.30.1060.10, 1 hit
HAMAPiMF_01401 MsrA, 1 hit
InterProiView protein in InterPro
IPR002569 Met_Sox_Rdtase_MsrA
IPR036509 Met_Sox_Rdtase_MsrA_sf
PfamiView protein in Pfam
PF01625 PMSR, 1 hit
SUPFAMiSSF55068 SSF55068, 1 hit
TIGRFAMsiTIGR00401 msrA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMSRA_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9D6Y7
Secondary accession number(s): Q5EBQ7, Q91WK9, Q9DCY2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 15, 2004
Last sequence update: June 1, 2001
Last modified: May 8, 2019
This is version 128 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again