Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9D666 (SUN1_MOUSE)

Entry version 162 (03 Jul 2019)
Sequence version 2 (02 Feb 2004)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

SUN domain-containing protein 1

Gene

Sun1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

As a component of the LINC (LInker of Nucleoskeleton and Cytoskeleton) complex involved in the connection between the nuclear lamina and the cytoskeleton (PubMed:20711465, PubMed:16380439, PubMed:24062341, PubMed:25892231, PubMed:26842404). The nucleocytoplasmic interactions established by the LINC complex play an important role in the transmission of mechanical forces across the nuclear envelope and in nuclear movement and positioning (PubMed:19874786). Required for interkinetic nuclear migration (INM) and essential for nucleokinesis and centrosome-nucleus coupling during radial neuronal migration in the cerebral cortex and during glial migration (PubMed:19874786). Involved in telomere attachment to nuclear envelope in the prophase of meiosis implicating a SUN1/2:KASH5 LINC complex in which SUN1 and SUN2 seem to act at least partial redundantly (PubMed:17543860, PubMed:19211677, PubMed:19509342, PubMed:24062341, PubMed:25892231, PubMed:26842404). Required for gametogenesis and involved in selective gene expression of coding and non-coding RNAs needed for gametogenesis (PubMed:17543860). Helps to define the distribution of nuclear pore complexes (NPCs) (PubMed:17724119). Required for efficient localization of SYNE4 in the nuclear envelope (PubMed:23348741). May be involved in nuclear remodeling during sperm head formation in spermatogenenis (PubMed:20711465). May play a role in DNA repair by suppressing non-homologous end joining repair to facilitate the repair of DNA cross-links (By similarity).By similarity11 Publications
Isoform 5 may be involved in nuclear remodeling during sperm head formation in spermatogenenis. A probable SUN1 isoform 5:SYNE3 LINC complex may tether spermatid nuclei to anterior cytoskeletal structures such as actin filaments present at membraneous junctions of spermatids and Sertoli cells.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processDifferentiation, Meiosis, Spermatogenesis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
SUN domain-containing protein 1
Alternative name(s):
Protein unc-84 homolog A
Sad1/unc-84 protein-like 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Sun1
Synonyms:Unc84a
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:1924303 Sun1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 415NuclearAdd BLAST415
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei416 – 436HelicalAdd BLAST21
Topological domaini437 – 913Perinuclear spaceAdd BLAST477

Keywords - Cellular componenti

Cytoplasmic vesicle, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mutant mice are viable, but display hearing loss at all frequencies.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002189121 – 913SUN domain-containing protein 1Add BLAST913

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei48PhosphoserineBy similarity1
Modified residuei66PhosphoserineCombined sources1
Modified residuei139PhosphoserineBy similarity1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi759Interchain (with KASH domain-containing nesprins)By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

The disulfid bond with KASH domain containing nesprins is required for stability of the respective LINC complexes under tensile forces.By similarity

Keywords - PTMi

Disulfide bond, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9D666

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9D666

PeptideAtlas

More...PeptideAtlasi		Q9D666

PRoteomics IDEntifications database

More...PRIDEi		Q9D666

PTM databases

GlyConnect protein glycosylation platform

More...GlyConnecti		2744

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9D666

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9D666

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Expressed in cochlear outer hair cells (at protein level). Seven isoforms are expressed in testis including testis-specific isoform 5. Isoform 5 is the only isoform expressed at the end of sperm differentiation. Six isoforms are expressed in muscle, heart and brain, four isoforms in kidney and three isoforms in liver.4 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000036817 Expressed in 296 organ(s), highest expression level in morula

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9D666 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9D666 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Core component of the LINC complex which is composed of inner nuclear membrane SUN domain-containing proteins coupled to outer nuclear membrane KASH domain-containing nesprins. SUN and KASH domain-containing proteins seem to bind each other promiscuously; however, differentially expression of LINC complex constituents is giving rise to specific assemblies. At least SUN1/2-containing core LINC complexes are proposed to be hexameric composed of three protomers of each KASH and SUN domain-containing protein.

Interacts with CCDC155/KASH5 (via the last 22 amino acids); this interaction mediates CCDC155 telomere localization by forming a SUN1:KASH5 LINC complex. Isoform 5 is proposed to form a non-nuclear spermatogenesis-specific LINC complex with SYNE3 during sperm head formation.

Interacts with SYNE2 and SYNE1; probably forming respective LINC complexes.

Interacts with A-type lamin with a strong preference for unprocessed A-type lamin compared with the mature protein. Interaction with lamins B1 and C is hardly detectable.

Interacts with NAT10.

Interacts with EMD and TSNAX. Associates with the nuclear pore complex (NPC).

Interacts with CCDC79/TERB1; promoting the accumulation of the LINC complex complexes at the telomere-nuclear envelope attachment sites.

By similarity10 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		218484, 6 interactors

Database of interacting proteins

More...DIPi		DIP-60732N

Protein interaction database and analysis system

More...IntActi		Q9D666, 8 interactors

Molecular INTeraction database

More...MINTi		Q9D666

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000056655

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1913
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9D666

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini751 – 912SUNPROSITE-ProRule annotationAdd BLAST162

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 139LMNA-bindingBy similarityAdd BLAST139
Regioni209 – 399SYNE2-bindingBy similarityAdd BLAST191
Regioni310 – 399EMD-bindingBy similarityAdd BLAST90
Regioni703 – 913Sufficient for interaction with SYNE1 and SYNE2By similarityAdd BLAST211

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili491 – 533Sequence analysisAdd BLAST43
Coiled coili563 – 638Sequence analysisAdd BLAST76

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The coiled coil domains differentially mediate trimerization required for binding to nesprins and are proposed to dynamically regulate the oligomeric state by locking the SUN domain in an inactive confirmation. The coiled coil domains are proposed to be involved in load-bearing and force transmission from the cytoskeleton.By similarity
The SUN domain may play a role in the nuclear anchoring and/or migration.

Keywords - Domaini

Coiled coil, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2687 Eukaryota
ENOG410YM6S LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155830

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000253025

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9D666

KEGG Orthology (KO)

More...KOi		K19347

Identification of Orthologs from Complete Genome Data

More...OMAi		EWLLQKF

Database of Orthologous Groups

More...OrthoDBi		1000585at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9D666

TreeFam database of animal gene trees

More...TreeFami		TF323915

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.120.260, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR008979 Galactose-bd-like_sf
IPR018539 SUN1
IPR032680 SUN1_N
IPR040994 Sun_CC2
IPR012919 SUN_dom

The PANTHER Classification System

More...PANTHERi		PTHR12911:SF23 PTHR12911:SF23, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF09387 MRP, 1 hit
PF07738 Sad1_UNC, 1 hit
PF18580 Sun2_CC2, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51469 SUN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Seven isoforms have been found to be expressed.

This entry has 5 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9D666-1) [UniParc]FASTAAdd to basket
Also known as: alpha

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDFSRLHTYT PPQCVPENTG YTYALSSSYS SDALDFETEH KLEPVFDSPR 
        60         70         80         90        100
MSRRSLRLVT TASYSSGDSQ AIDSHISTSR ATPAKGRETR TVKQRRSASK 
       110        120        130        140        150
PAFSINHLSG KGLSSSTSHD SSCSLRSATV LRHPVLDESL IREQTKVDHF 
       160        170        180        190        200
WGLDDDGDLK GGNKAATQGN GELAAEVASS NGYTCRDCRM LSARTDALTA 
       210        220        230        240        250
HSAIHGTTSR VYSRDRTLKP RGVSFYLDRT LWLAKSTSSS FASFIVQLFQ 
       260        270        280        290        300
VVLMKLNFET YKLKGYESRA YESQSYETKS HESEAHLGHC GRMTAGELSR 
       310        320        330        340        350
VDGESLCDDC KGKKHLEIHT ATHSQLPQPH RVAGAMGRLC IYTGDLLVQA 
       360        370        380        390        400
LRRTRAAGWS VAEAVWSVLW LAVSAPGKAA SGTFWWLGSG WYQFVTLISW 
       410        420        430        440        450
LNVFLLTRCL RNICKVFVLL LPLLLLLGAG VSLWGQGNFF SLLPVLNWTA 
       460        470        480        490        500
MQPTQRVDDS KGMHRPGPLP PSPPPKVDHK ASQWPQESDM GQKVASLSAQ 
       510        520        530        540        550
CHNHDERLAE LTVLLQKLQI RVDQVDDGRE GLSLWVKNVV GQHLQEMGTI 
       560        570        580        590        600
EPPDAKTDFM TFHHDHEVRL SNLEDVLRKL TEKSEAIQKE LEETKLKAGS 
       610        620        630        640        650
RDEEQPLLDR VQHLELELNL LKSQLSDWQH LKTSCEQAGA RIQETVQLMF 
       660        670        680        690        700
SEDQQGGSLE WLLEKLSSRF VSKDELQVLL HDLELKLLQN ITHHITVTGQ 
       710        720        730        740        750
APTSEAIVSA VNQAGISGIT EAQAHIIVNN ALKLYSQDKT GMVDFALESG 
       760        770        780        790        800
GGSILSTRCS ETYETKTALL SLFGVPLWYF SQSPRVVIQP DIYPGNCWAF 
       810        820        830        840        850
KGSQGYLVVR LSMKIYPTTF TMEHIPKTLS PTGNISSAPK DFAVYGLETE 
       860        870        880        890        900
YQEEGQPLGR FTYDQEGDSL QMFHTLERPD QAFQIVELRV LSNWGHPEYT 
       910 
CLYRFRVHGE PIQ
Length:913
Mass (Da):101,976
Last modified:February 2, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB9872C8F2E044964
GO
Isoform 2 (identifier: Q9D666-2) [UniParc]FASTAAdd to basket
Also known as: zeta

The sequence of this isoform differs from the canonical sequence as follows:
     222-344: Missing.

Show »
Length:790
Mass (Da):88,203
Checksum:i127979E6640F2CD4
GO
Isoform 3 (identifier: Q9D666-3) [UniParc]FASTAAdd to basket
Also known as: beta

The sequence of this isoform differs from the canonical sequence as follows:
     308-344: Missing.

Show »
Length:876
Mass (Da):97,924
Checksum:i09357E280A0B8392
GO
Isoform 4 (identifier: Q9D666-4) [UniParc]FASTAAdd to basket
Also known as: delta

The sequence of this isoform differs from the canonical sequence as follows:
     221-285: RGVSFYLDRTLWLAKSTSSSFASFIVQLFQVVLMKLNFETYKLKGYESRAYESQSYETKSHESEA → P

Show »
Length:849
Mass (Da):94,507
Checksum:i7810982DFA292D25
GO
Isoform 5 (identifier: Q9D666-5) [UniParc]FASTAAdd to basket
Also known as: eta

The sequence of this isoform differs from the canonical sequence as follows:
     222-377: Missing.

Show »
Length:757
Mass (Da):84,671
Checksum:i764BD7C53D24CCA3
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q3TSM1Q3TSM1_MOUSE
SUN domain-containing protein 1
Sun1 Unc84a
239Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z5Q2D3Z5Q2_MOUSE
SUN domain-containing protein 1
Sun1
158Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z3N5D3Z3N5_MOUSE
SUN domain-containing protein 1
Sun1
160Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z1X3D3Z1X3_MOUSE
SUN domain-containing protein 1
Sun1
131Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3YUW9D3YUW9_MOUSE
SUN domain-containing protein 1
Sun1
175Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6XYA0F6XYA0_MOUSE
SUN domain-containing protein 1
Sun1
256Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F7AJ01F7AJ01_MOUSE
SUN domain-containing protein 1
Sun1
117Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6RMJ1F6RMJ1_MOUSE
SUN domain-containing protein 1
Sun1
258Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F7BX07F7BX07_MOUSE
SUN domain-containing protein 1
Sun1
197Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z0L7D3Z0L7_MOUSE
SUN domain-containing protein 1
Sun1
53Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH30330 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti6L → V in AAT90501 (PubMed:17132086).Curated1
Sequence conflicti108L → P in BAE39733 (PubMed:16141072).Curated1
Sequence conflicti439F → L in AAT90501 (PubMed:17132086).Curated1
Sequence conflicti479H → N in BAE35723 (PubMed:16141072).Curated1
Sequence conflicti505D → G in BAE39733 (PubMed:16141072).Curated1
Sequence conflicti593E → A in BAE39733 (PubMed:16141072).Curated1
Sequence conflicti704S → F in BAE39733 (PubMed:16141072).Curated1
Sequence conflicti856 – 857QP → AA in AAK13526 (PubMed:12036294).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_039552221 – 285RGVSF…HESEA → P in isoform 4. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_058699222 – 377Missing in isoform 5. 1 PublicationAdd BLAST156
Alternative sequenceiVSP_009346222 – 344Missing in isoform 2. 1 PublicationAdd BLAST123
Alternative sequenceiVSP_009347308 – 344Missing in isoform 3. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AY682989 mRNA Translation: AAT90501.1
HQ402597 mRNA Translation: ADP89697.1
AK014585 mRNA Translation: BAB29445.1
AK036187 mRNA Translation: BAC29339.1
AK160281 mRNA Translation: BAE35723.1
AK167686 mRNA Translation: BAE39733.1
AC125065 Genomic DNA No translation available.
BC030330 mRNA Translation: AAH30330.1 Different initiation.
BC047928 mRNA Translation: AAH47928.1
BC048156 mRNA Translation: AAH48156.1
AF343752 mRNA Translation: AAK13526.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS19804.1 [Q9D666-1]
CCDS57395.1 [Q9D666-3]
CCDS57396.1 [Q9D666-4]
CCDS57397.1 [Q9D666-2]
CCDS57398.1 [Q9D666-5]

NCBI Reference Sequences

More...RefSeqi		NP_001243044.1, NM_001256115.1 [Q9D666-3]
NP_001243045.1, NM_001256116.1 [Q9D666-4]
NP_001243046.1, NM_001256117.1 [Q9D666-2]
NP_001243047.1, NM_001256118.1 [Q9D666-5]
NP_077771.1, NM_024451.2 [Q9D666-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000058716; ENSMUSP00000056655; ENSMUSG00000036817 [Q9D666-1]
ENSMUST00000078690; ENSMUSP00000077756; ENSMUSG00000036817 [Q9D666-4]
ENSMUST00000110882; ENSMUSP00000106506; ENSMUSG00000036817 [Q9D666-5]
ENSMUST00000110883; ENSMUSP00000106507; ENSMUSG00000036817 [Q9D666-2]
ENSMUST00000110884; ENSMUSP00000106508; ENSMUSG00000036817 [Q9D666-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		77053

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:77053

UCSC genome browser

More...UCSCi		uc009agb.2 mouse [Q9D666-1]
uc009agc.2 mouse [Q9D666-3]
uc009agd.2 mouse [Q9D666-2]
uc009age.2 mouse [Q9D666-4]
uc012efr.2 mouse

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY682989 mRNA Translation: AAT90501.1
HQ402597 mRNA Translation: ADP89697.1
AK014585 mRNA Translation: BAB29445.1
AK036187 mRNA Translation: BAC29339.1
AK160281 mRNA Translation: BAE35723.1
AK167686 mRNA Translation: BAE39733.1
AC125065 Genomic DNA No translation available.
BC030330 mRNA Translation: AAH30330.1 Different initiation.
BC047928 mRNA Translation: AAH47928.1
BC048156 mRNA Translation: AAH48156.1
AF343752 mRNA Translation: AAK13526.1
CCDSiCCDS19804.1 [Q9D666-1]
CCDS57395.1 [Q9D666-3]
CCDS57396.1 [Q9D666-4]
CCDS57397.1 [Q9D666-2]
CCDS57398.1 [Q9D666-5]
RefSeqiNP_001243044.1, NM_001256115.1 [Q9D666-3]
NP_001243045.1, NM_001256116.1 [Q9D666-4]
NP_001243046.1, NM_001256117.1 [Q9D666-2]
NP_001243047.1, NM_001256118.1 [Q9D666-5]
NP_077771.1, NM_024451.2 [Q9D666-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5YWZX-ray2.20A672-913[»]
SMRiQ9D666
ModBaseiSearch...

Protein-protein interaction databases

BioGridi218484, 6 interactors
DIPiDIP-60732N
IntActiQ9D666, 8 interactors
MINTiQ9D666
STRINGi10090.ENSMUSP00000056655

PTM databases

GlyConnecti2744
iPTMnetiQ9D666
PhosphoSitePlusiQ9D666

Proteomic databases

EPDiQ9D666
PaxDbiQ9D666
PeptideAtlasiQ9D666
PRIDEiQ9D666

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000058716; ENSMUSP00000056655; ENSMUSG00000036817 [Q9D666-1]
ENSMUST00000078690; ENSMUSP00000077756; ENSMUSG00000036817 [Q9D666-4]
ENSMUST00000110882; ENSMUSP00000106506; ENSMUSG00000036817 [Q9D666-5]
ENSMUST00000110883; ENSMUSP00000106507; ENSMUSG00000036817 [Q9D666-2]
ENSMUST00000110884; ENSMUSP00000106508; ENSMUSG00000036817 [Q9D666-3]
GeneIDi77053
KEGGimmu:77053
UCSCiuc009agb.2 mouse [Q9D666-1]
uc009agc.2 mouse [Q9D666-3]
uc009agd.2 mouse [Q9D666-2]
uc009age.2 mouse [Q9D666-4]
uc012efr.2 mouse

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		23353
MGIiMGI:1924303 Sun1

Phylogenomic databases

eggNOGiKOG2687 Eukaryota
ENOG410YM6S LUCA
GeneTreeiENSGT00940000155830
HOGENOMiHOG000253025
InParanoidiQ9D666
KOiK19347
OMAiEWLLQKF
OrthoDBi1000585at2759
PhylomeDBiQ9D666
TreeFamiTF323915

Miscellaneous databases

Protein Ontology

More...PROi		PR:Q9D666

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000036817 Expressed in 296 organ(s), highest expression level in morula
ExpressionAtlasiQ9D666 baseline and differential
GenevisibleiQ9D666 MM

Family and domain databases

Gene3Di2.60.120.260, 1 hit
InterProiView protein in InterPro
IPR008979 Galactose-bd-like_sf
IPR018539 SUN1
IPR032680 SUN1_N
IPR040994 Sun_CC2
IPR012919 SUN_dom
PANTHERiPTHR12911:SF23 PTHR12911:SF23, 1 hit
PfamiView protein in Pfam
PF09387 MRP, 1 hit
PF07738 Sad1_UNC, 1 hit
PF18580 Sun2_CC2, 1 hit
PROSITEiView protein in PROSITE
PS51469 SUN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSUN1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9D666
Secondary accession number(s): D3Z0V9
, Q3TIW3, Q3TV96, Q6B4H0, Q80SU8, Q8BZ99, Q99P23
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 2, 2002
Last sequence update: February 2, 2004
Last modified: July 3, 2019
This is version 162 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again