Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

TATA box-binding protein-associated factor RNA polymerase I subunit D

Gene

Taf1d

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Component of the transcription factor SL1/TIF-IB complex, which is involved in the assembly of the PIC (preinitiation complex) during RNA polymerase I-dependent transcription. The rate of PIC formation probably is primarily dependent on the rate of association of SL1/TIF-IB with the rDNA promoter. SL1/TIF-IB is involved in stabilization of nucleolar transcription factor 1/UBTF on rDNA. Formation of SL1/TIF-IB excludes the association of TBP with TFIID subunits (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-MMU-5250924 B-WICH complex positively regulates rRNA expression
R-MMU-73762 RNA Polymerase I Transcription Initiation
R-MMU-73772 RNA Polymerase I Promoter Escape
R-MMU-73777 RNA Polymerase I Chain Elongation
R-MMU-73863 RNA Polymerase I Transcription Termination

Names & Taxonomyi

Protein namesi
Recommended name:
TATA box-binding protein-associated factor RNA polymerase I subunit D
Alternative name(s):
TATA box-binding protein-associated factor 1D
Short name:
TBP-associated factor 1D
Transcription initiation factor SL1/TIF-IB subunit D
Gene namesi
Name:Taf1d
Synonyms:Josd3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 9

Organism-specific databases

MGIiMGI:1922566 Taf1d

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002507181 – 322TATA box-binding protein-associated factor RNA polymerase I subunit DAdd BLAST322

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei23PhosphoserineBy similarity1
Modified residuei137PhosphoserineBy similarity1
Modified residuei232PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9D4V4
PeptideAtlasiQ9D4V4
PRIDEiQ9D4V4

PTM databases

iPTMnetiQ9D4V4
PhosphoSitePlusiQ9D4V4

Expressioni

Gene expression databases

BgeeiENSMUSG00000031939 Expressed in 270 organ(s), highest expression level in ear
ExpressionAtlasiQ9D4V4 baseline and differential
GenevisibleiQ9D4V4 MM

Interactioni

Subunit structurei

Component of the transcription factor SL1/TIF-IB complex, composed of TBP and at least TAF1A, TAF1B, TAF1C and TAF1D. Interacts with UBTF (By similarity).By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000034415

Structurei

3D structure databases

ProteinModelPortaliQ9D4V4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410IZI3 Eukaryota
ENOG41124VA LUCA
GeneTreeiENSGT00390000009061
HOGENOMiHOG000154498
HOVERGENiHBG096071
InParanoidiQ9D4V4
KOiK15215
OMAiNEDFDSR
OrthoDBiEOG091G0D0N
PhylomeDBiQ9D4V4
TreeFamiTF335756

Family and domain databases

InterProiView protein in InterPro
IPR027976 TAF1D
PANTHERiPTHR14562 PTHR14562, 1 hit
PfamiView protein in Pfam
PF15333 TAF1D, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9D4V4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAQSEVNSVC VASDRAGDTG DQSDDSSDGS LFKTQCAPSP IQKQRHPTVK
60 70 80 90 100
RVTLPASVET DSSSDSSIEP RPLTLKAIFE RFKKKKRKKR KKRKYEPKLR
110 120 130 140 150
PRGRPRGKPS GTRITRRSQI DAKQIKDKGA VFPFLESESG RKPLPWKKIL
160 170 180 190 200
TYEQAVARGF FHHIEKLKYE HHLKECLKQM HAGEDLEKED LDSRRHKYMD
210 220 230 240 250
DDGSLSPIEE PLTEDEATNP QAECDIKLVE DSCFIISSEF SRKRNLEQEK
260 270 280 290 300
IKKESTFSKK AKDATHREKG HRRTLKGNEH VTIEEDSRPQ PRPFAHLQSK
310 320
VMKKGELEYL EVHHLCGLSQ PL
Length:322
Mass (Da):36,977
Last modified:October 3, 2006 - v2
Checksum:iBDA75165CEC29301
GO
Isoform 2 (identifier: Q9D4V4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     286-322: DSRPQPRPFAHLQSKVMKKGELEYLEVHHLCGLSQPL → GKEHR

Show »
Length:290
Mass (Da):33,333
Checksum:i6B62160C9644531A
GO
Isoform 3 (identifier: Q9D4V4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     286-322: DSRPQPRPFAHLQSKVMKKGELEYLEVHHLCGLSQPL → GLS

Show »
Length:288
Mass (Da):32,982
Checksum:i98A88644531A1757
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1L1SUD1A0A1L1SUD1_MOUSE
TATA box-binding protein-associated...
Taf1d
153Annotation score:
A0A1L1SUU1A0A1L1SUU1_MOUSE
TATA box-binding protein-associated...
Taf1d
92Annotation score:
A0A1L1STW1A0A1L1STW1_MOUSE
TATA box-binding protein-associated...
Taf1d
122Annotation score:
A0A1L1SRB1A0A1L1SRB1_MOUSE
TATA box-binding protein-associated...
Taf1d
23Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti8S → F in BAB29621 (PubMed:16141072).Curated1
Sequence conflicti148K → R in BAB29621 (PubMed:16141072).Curated1
Sequence conflicti173L → P in BAB29621 (PubMed:16141072).Curated1
Sequence conflicti276K → E in BAB30118 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_020729286 – 322DSRPQ…LSQPL → GKEHR in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_020730286 – 322DSRPQ…LSQPL → GLS in isoform 3. 2 PublicationsAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK050165 mRNA Translation: BAC34104.1
AK012662 mRNA Translation: BAB28391.1
AK014920 mRNA Translation: BAB29621.1
AK016109 mRNA Translation: BAB30118.1
AK166329 mRNA Translation: BAE38709.1
BC110660 mRNA Translation: AAI10661.1
BC117068 mRNA Translation: AAI17069.1
BC117070 mRNA Translation: AAI17071.1
CCDSiCCDS22836.1 [Q9D4V4-1]
CCDS52726.1 [Q9D4V4-2]
RefSeqiNP_081537.1, NM_027261.3 [Q9D4V4-2]
NP_083524.2, NM_029248.2 [Q9D4V4-1]
XP_006510726.1, XM_006510663.2 [Q9D4V4-1]
XP_011240922.1, XM_011242620.2 [Q9D4V4-1]
UniGeneiMm.354115

Genome annotation databases

EnsembliENSMUST00000034415; ENSMUSP00000034415; ENSMUSG00000031939 [Q9D4V4-1]
ENSMUST00000164079; ENSMUSP00000129141; ENSMUSG00000031939 [Q9D4V4-2]
ENSMUST00000213763; ENSMUSP00000150356; ENSMUSG00000031939 [Q9D4V4-3]
ENSMUST00000214054; ENSMUSP00000150937; ENSMUSG00000031939 [Q9D4V4-3]
ENSMUST00000216825; ENSMUSP00000149377; ENSMUSG00000031939 [Q9D4V4-3]
GeneIDi75316
KEGGimmu:75316
UCSCiuc009ofp.2 mouse [Q9D4V4-1]
uc009ofq.2 mouse [Q9D4V4-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK050165 mRNA Translation: BAC34104.1
AK012662 mRNA Translation: BAB28391.1
AK014920 mRNA Translation: BAB29621.1
AK016109 mRNA Translation: BAB30118.1
AK166329 mRNA Translation: BAE38709.1
BC110660 mRNA Translation: AAI10661.1
BC117068 mRNA Translation: AAI17069.1
BC117070 mRNA Translation: AAI17071.1
CCDSiCCDS22836.1 [Q9D4V4-1]
CCDS52726.1 [Q9D4V4-2]
RefSeqiNP_081537.1, NM_027261.3 [Q9D4V4-2]
NP_083524.2, NM_029248.2 [Q9D4V4-1]
XP_006510726.1, XM_006510663.2 [Q9D4V4-1]
XP_011240922.1, XM_011242620.2 [Q9D4V4-1]
UniGeneiMm.354115

3D structure databases

ProteinModelPortaliQ9D4V4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000034415

PTM databases

iPTMnetiQ9D4V4
PhosphoSitePlusiQ9D4V4

Proteomic databases

PaxDbiQ9D4V4
PeptideAtlasiQ9D4V4
PRIDEiQ9D4V4

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000034415; ENSMUSP00000034415; ENSMUSG00000031939 [Q9D4V4-1]
ENSMUST00000164079; ENSMUSP00000129141; ENSMUSG00000031939 [Q9D4V4-2]
ENSMUST00000213763; ENSMUSP00000150356; ENSMUSG00000031939 [Q9D4V4-3]
ENSMUST00000214054; ENSMUSP00000150937; ENSMUSG00000031939 [Q9D4V4-3]
ENSMUST00000216825; ENSMUSP00000149377; ENSMUSG00000031939 [Q9D4V4-3]
GeneIDi75316
KEGGimmu:75316
UCSCiuc009ofp.2 mouse [Q9D4V4-1]
uc009ofq.2 mouse [Q9D4V4-2]

Organism-specific databases

CTDi79101
MGIiMGI:1922566 Taf1d

Phylogenomic databases

eggNOGiENOG410IZI3 Eukaryota
ENOG41124VA LUCA
GeneTreeiENSGT00390000009061
HOGENOMiHOG000154498
HOVERGENiHBG096071
InParanoidiQ9D4V4
KOiK15215
OMAiNEDFDSR
OrthoDBiEOG091G0D0N
PhylomeDBiQ9D4V4
TreeFamiTF335756

Enzyme and pathway databases

ReactomeiR-MMU-5250924 B-WICH complex positively regulates rRNA expression
R-MMU-73762 RNA Polymerase I Transcription Initiation
R-MMU-73772 RNA Polymerase I Promoter Escape
R-MMU-73777 RNA Polymerase I Chain Elongation
R-MMU-73863 RNA Polymerase I Transcription Termination

Miscellaneous databases

ChiTaRSiTaf1d mouse
PROiPR:Q9D4V4
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000031939 Expressed in 270 organ(s), highest expression level in ear
ExpressionAtlasiQ9D4V4 baseline and differential
GenevisibleiQ9D4V4 MM

Family and domain databases

InterProiView protein in InterPro
IPR027976 TAF1D
PANTHERiPTHR14562 PTHR14562, 1 hit
PfamiView protein in Pfam
PF15333 TAF1D, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiTAF1D_MOUSE
AccessioniPrimary (citable) accession number: Q9D4V4
Secondary accession number(s): Q149X7
, Q8C7I5, Q9CZG0, Q9D5U6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: October 3, 2006
Last modified: November 7, 2018
This is version 109 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again