Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 137 (07 Oct 2020)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Add a publicationFeedback
Protein

PHD finger protein 14

Gene

Phf14

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri312 – 373PHD-type 1PROSITE-ProRule annotationAdd BLAST62
Zinc fingeri375 – 408C2HC pre-PHD-typePROSITE-ProRule annotationAdd BLAST34
Zinc fingeri432 – 492PHD-type 2PROSITE-ProRule annotationAdd BLAST61
Zinc fingeri718 – 772PHD-type 3PROSITE-ProRule annotationAdd BLAST55

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
PHD finger protein 14
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Phf14
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1923539, Phf14

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000593071 – 881PHD finger protein 14Add BLAST881

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei26PhosphoserineBy similarity1
Modified residuei29PhosphoserineBy similarity1
Modified residuei84PhosphoserineBy similarity1
Modified residuei189PhosphoserineBy similarity1
Modified residuei199PhosphotyrosineBy similarity1
Modified residuei201PhosphoserineBy similarity1
Modified residuei280PhosphothreonineCombined sources1
Modified residuei283PhosphoserineCombined sources1
Modified residuei287PhosphoserineBy similarity1
Modified residuei291PhosphoserineBy similarity1
Modified residuei295PhosphoserineBy similarity1
Modified residuei301PhosphoserineBy similarity1
Modified residuei352PhosphoserineBy similarity1
Modified residuei523PhosphoserineBy similarity1
Modified residuei774PhosphoserineCombined sources1
Modified residuei775PhosphoserineCombined sources1
Modified residuei828PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9D4H9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9D4H9

PeptideAtlas

More...
PeptideAtlasi
Q9D4H9

PRoteomics IDEntifications database

More...
PRIDEi
Q9D4H9

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9D4H9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9D4H9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000029629, Expressed in metanephros and 274 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9D4H9, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9D4H9, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
217694, 8 interactors

Protein interaction database and analysis system

More...
IntActi
Q9D4H9, 1 interactor

Molecular INTeraction database

More...
MINTi
Q9D4H9

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000111172

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9D4H9, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9D4H9

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi62 – 129Glu-richAdd BLAST68

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri312 – 373PHD-type 1PROSITE-ProRule annotationAdd BLAST62
Zinc fingeri375 – 408C2HC pre-PHD-typePROSITE-ProRule annotationAdd BLAST34
Zinc fingeri432 – 492PHD-type 2PROSITE-ProRule annotationAdd BLAST61
Zinc fingeri718 – 772PHD-type 3PROSITE-ProRule annotationAdd BLAST55

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0957, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156923

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_006506_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9D4H9

Identification of Orthologs from Complete Genome Data

More...
OMAi
LVMCDEC

Database of Orthologous Groups

More...
OrthoDBi
566217at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9D4H9

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.40.10, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR034732, EPHD
IPR019786, Zinc_finger_PHD-type_CS
IPR011011, Znf_FYVE_PHD
IPR001965, Znf_PHD
IPR019787, Znf_PHD-finger
IPR013083, Znf_RING/FYVE/PHD

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00628, PHD, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00249, PHD, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57903, SSF57903, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51805, EPHD, 1 hit
PS01359, ZF_PHD_1, 2 hits
PS50016, ZF_PHD_2, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9D4H9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDRSSKRRQV KPLAASLLEA LDYDSSDDSD FKVGDASDSE GSGNGSEDPS
60 70 80 90 100
KDSGEGSCSD SEENILEEEL NEDIQVKEEQ LKNSTEEIMP SDKQLIKMEK
110 120 130 140 150
KEEEENGERP RKKKEKEKEK EKEREKDKEK ATVSDSAAAS AAGTTPATSP
160 170 180 190 200
PAVTSPSVPT TTTTTTEEQV SEPKKWNLRR NRPLLDFVSM EELNAMDDYD
210 220 230 240 250
SEDDNDWRPT VVKRKGRSAS QKEGSDGDNE DDDDEGSGSE EDENDEGNDE
260 270 280 290 300
DHSSPASEAG GKKKRSKVLS RNSADDEELT NDSLTLSQSK SNEDSLILEK
310 320 330 340 350
SQNWSSQKMD HILICCVCLG DNSEDADEII QCDNCGITVH EGCYGVDGES
360 370 380 390 400
DSIMSSASEN STEPWFCDAC KCGVSPSCEL CPNQDGIFKE TDAGRWVHIV
410 420 430 440 450
CALYVPGVAF GDIDKLRPVT LTEMNYSKYG AKECSFCEDP RFARTGVCIS
460 470 480 490 500
CDAGMCRAYF HVTCAQKEGL LSEAAAEEDI ADPFFAYCKQ HADRLDRKWK
510 520 530 540 550
RKNYLALQSY CKMSLQEREK QLSPEAQARI NARLQQYRAK AELARSTRPQ
560 570 580 590 600
AWVPREKLPR PLTSSASAIR KLMRKAELMG ISTDIFPVDN SDTSSSVDGR
610 620 630 640 650
RKHKQPALTA DFVNYYFERN MRMIQIQENM AEQKNIKDKL ENEQEKLHVE
660 670 680 690 700
YNKLCESLEE LQNLNGKLRS EGQGIWALLG RITGQKLNVP AILRAPKERK
710 720 730 740 750
PSKKEGGTQK TSALPTVLYS CGICKKNHDQ HLLLLCDTCK LHYHLGCLDP
760 770 780 790 800
PLTRMPRKTK NSYWQCSECD QAGSSDMEAE MAMETLPDGT KRSRRQIKEP
810 820 830 840 850
VKFVPQDVPP EPKKIPIRNT RTRGRKRSFV PEEEKHEERV PRERRQRQSV
860 870 880
LQKKPKAEDL RTECSTCKGT GDNENLVRNL T
Length:881
Mass (Da):99,105
Last modified:June 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i21E0EA172F96B20D
GO
Isoform 2 (identifier: Q9D4H9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     879-881: NLT → CDECRLCYHFGCLDPPLKKSPKQTGYGWICQECDSSSSKEDENEAEKKNASQELSMEQKTPKK

Show »
Length:941
Mass (Da):105,947
Checksum:iC60E58C89C3B6252
GO
Isoform 3 (identifier: Q9D4H9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     879-881: Missing.

Show »
Length:878
Mass (Da):98,777
Checksum:i872F96B20D6DC2D1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F6TN92F6TN92_MOUSE
PHD finger protein 14
Phf14
243Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G5E8S0G5E8S0_MOUSE
PHD finger protein 14
Phf14
881Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0N4SV73A0A0N4SV73_MOUSE
PHD finger protein 14
Phf14
90Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0N4SWI1A0A0N4SWI1_MOUSE
PHD finger protein 14
Phf14
69Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0N4SW36A0A0N4SW36_MOUSE
PHD finger protein 14
Phf14
42Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB22644 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti133V → I in AAH40236 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_010349879 – 881NLT → CDECRLCYHFGCLDPPLKKS PKQTGYGWICQECDSSSSKE DENEAEKKNASQELSMEQKT PKK in isoform 2. 1 Publication3
Alternative sequenceiVSP_010348879 – 881Missing in isoform 3. 1 Publication3

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK003209 mRNA Translation: BAB22644.1 Different initiation.
AK016517 mRNA Translation: BAB30282.1
AK089073 mRNA Translation: BAC40735.1
BC040236 mRNA Translation: AAH40236.1
AY162410 Genomic DNA Translation: AAO17166.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS39428.1 [Q9D4H9-1]
CCDS51720.1 [Q9D4H9-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001161854.1, NM_001168382.1 [Q9D4H9-2]
NP_083680.2, NM_029404.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000090632; ENSMUSP00000088126; ENSMUSG00000029629 [Q9D4H9-3]
ENSMUST00000115511; ENSMUSP00000111173; ENSMUSG00000029629 [Q9D4H9-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
75725

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:75725

UCSC genome browser

More...
UCSCi
uc009ayf.1, mouse [Q9D4H9-1]
uc009ayg.2, mouse [Q9D4H9-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK003209 mRNA Translation: BAB22644.1 Different initiation.
AK016517 mRNA Translation: BAB30282.1
AK089073 mRNA Translation: BAC40735.1
BC040236 mRNA Translation: AAH40236.1
AY162410 Genomic DNA Translation: AAO17166.1
CCDSiCCDS39428.1 [Q9D4H9-1]
CCDS51720.1 [Q9D4H9-2]
RefSeqiNP_001161854.1, NM_001168382.1 [Q9D4H9-2]
NP_083680.2, NM_029404.3

3D structure databases

SMRiQ9D4H9
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi217694, 8 interactors
IntActiQ9D4H9, 1 interactor
MINTiQ9D4H9
STRINGi10090.ENSMUSP00000111172

PTM databases

iPTMnetiQ9D4H9
PhosphoSitePlusiQ9D4H9

Proteomic databases

jPOSTiQ9D4H9
PaxDbiQ9D4H9
PeptideAtlasiQ9D4H9
PRIDEiQ9D4H9

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
629, 84 antibodies

Genome annotation databases

EnsembliENSMUST00000090632; ENSMUSP00000088126; ENSMUSG00000029629 [Q9D4H9-3]
ENSMUST00000115511; ENSMUSP00000111173; ENSMUSG00000029629 [Q9D4H9-2]
GeneIDi75725
KEGGimmu:75725
UCSCiuc009ayf.1, mouse [Q9D4H9-1]
uc009ayg.2, mouse [Q9D4H9-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9678
MGIiMGI:1923539, Phf14

Phylogenomic databases

eggNOGiKOG0957, Eukaryota
GeneTreeiENSGT00940000156923
HOGENOMiCLU_006506_0_0_1
InParanoidiQ9D4H9
OMAiLVMCDEC
OrthoDBi566217at2759
PhylomeDBiQ9D4H9

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
75725, 1 hit in 18 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Phf14, mouse

Protein Ontology

More...
PROi
PR:Q9D4H9
RNActiQ9D4H9, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000029629, Expressed in metanephros and 274 other tissues
ExpressionAtlasiQ9D4H9, baseline and differential
GenevisibleiQ9D4H9, MM

Family and domain databases

Gene3Di3.30.40.10, 3 hits
InterProiView protein in InterPro
IPR034732, EPHD
IPR019786, Zinc_finger_PHD-type_CS
IPR011011, Znf_FYVE_PHD
IPR001965, Znf_PHD
IPR019787, Znf_PHD-finger
IPR013083, Znf_RING/FYVE/PHD
PfamiView protein in Pfam
PF00628, PHD, 2 hits
SMARTiView protein in SMART
SM00249, PHD, 3 hits
SUPFAMiSSF57903, SSF57903, 2 hits
PROSITEiView protein in PROSITE
PS51805, EPHD, 1 hit
PS01359, ZF_PHD_1, 2 hits
PS50016, ZF_PHD_2, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPHF14_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9D4H9
Secondary accession number(s): Q810Z6
, Q8C284, Q8CGF8, Q9D1Q8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 15, 2003
Last sequence update: June 1, 2001
Last modified: October 7, 2020
This is version 137 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again