Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9D3R6 (KATL2_MOUSE)

Entry version 146 (02 Dec 2020)
Sequence version 2 (20 May 2008)
Previous versions | rss
Add a publicationFeedback
Protein

Katanin p60 ATPase-containing subunit A-like 2

Gene

Katnal2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Severs microtubules in vitro in an ATP-dependent manner. This activity may promote rapid reorganization of cellular microtubule arrays.UniRule annotation

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • n ATP + n H(2)O + a microtubule = n ADP + n phosphate + (n+1) alpha/beta tubulin heterodimers.UniRule annotation EC:5.6.1.1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi295 – 302ATPUniRule annotation8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIsomerase
LigandATP-binding, Nucleotide-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Katanin p60 ATPase-containing subunit A-like 2UniRule annotation (EC:5.6.1.1UniRule annotation)
Short name:
Katanin p60 subunit A-like 2UniRule annotation
Alternative name(s):
p60 katanin-like 2UniRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Katnal2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 18

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:1924234, Katnal2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003337931 – 539Katanin p60 ATPase-containing subunit A-like 2Add BLAST539

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9D3R6

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9D3R6

PRoteomics IDEntifications database

More...PRIDEi		Q9D3R6

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9D3R6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9D3R6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000025420, Expressed in spermatid and 148 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9D3R6, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9D3R6, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000026486

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9D3R6, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9D3R6

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini25 – 57LisHUniRule annotationAdd BLAST33

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the AAA ATPase family. Katanin p60 subunit A1 subfamily. A-like 2 sub-subfamily.UniRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0738, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000157302

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_000688_21_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9D3R6

Database of Orthologous Groups

More...OrthoDBi		787710at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9D3R6

TreeFam database of animal gene trees

More...TreeFami		TF329610

Family and domain databases

HAMAP database of protein families

More...HAMAPi		MF_03025, Katanin_p60_AL2, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR003593, AAA+_ATPase
IPR041569, AAA_lid_3
IPR003959, ATPase_AAA_core
IPR027497, Katanin_p60_AL2
IPR006594, LisH
IPR027417, P-loop_NTPase

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00004, AAA, 1 hit
PF17862, AAA_lid_3, 1 hit
PF08513, LisH, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00382, AAA, 1 hit
SM00667, LisH, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF52540, SSF52540, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50896, LISH, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9D3R6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MELSYQTLKL THQAREAYEM RTEARRKNLL ILILHYLTQE GYMDAAKALE 
        60         70         80         90        100
EETKLGLRRF EVCDNVDLET ILMEYESYYF VKFQKYPKVV KKAPDPVENN 
       110        120        130        140        150
LPSRSGGKNK RLTNDSCQNL PKICHQKSRP KTSAVKTGDT KSVKEHLKQV 
       160        170        180        190        200
KESVTDTQAE STDFGLNISK IHKDQPEEKA QPRRGQIIDF RGLLSDAIKG 
       210        220        230        240        250
ATSEFALNTF ECNPDPSERL LKPLSAFIGM NSEMRELAAV VSRDIYLHNP 
       260        270        280        290        300
NIKWNDIIGL DAAKQLVKEA VVYPIRYPQL FTGILSPWKG LLLYGPPGTG 
       310        320        330        340        350
KTLLAKAVAT ECKTTFFNIS ASTIVSKWRG DSEKLVRVLF ELARYHAPST 
       360        370        380        390        400
IFLDELESVM SQRGMVPGGE HEGSLRMKTE LLVQMDGLAR SEDLVFVLAA 
       410        420        430        440        450
SNLPWELDCA MLRRLEKRIL VDLPSQEARQ AMIYHWLPPV SKNHALELHT 
       460        470        480        490        500
QLEYSVLSQE TEGYSGSDIK LVCREAAMRP VRKIFSVLEN NQSESNNLPG 
       510        520        530 
IQLDTVTTQD FLDVLAHTKP SAKNLTERYL AWQEKFESV
Length:539
Mass (Da):61,153
Last modified:May 20, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i199E141AEF2F402C
GO
Isoform 2 (identifier: Q9D3R6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     150-151: Missing.
     185-219: GQIIDFRGLLSDAIKGATSEFALNTFECNPDPSER → VSGAQGPRMERGTCLKKKENKAYSCCQTGKRRQKH
     220-539: Missing.

Show »
Length:217
Mass (Da):25,054
Checksum:i64C8E9B44E93C16D
GO
Isoform 3 (identifier: Q9D3R6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     407-409: LDC → GDA
     410-539: Missing.

Show »
Length:409
Mass (Da):46,131
Checksum:i9600B20008DC9749
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3Z4J2D3Z4J2_MOUSE
Katanin p60 ATPase-containing subun...
Katnal2 KATNAL2
495Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RGM7D6RGM7_MOUSE
Katanin p60 ATPase-containing subun...
Katnal2
372Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z0U5D3Z0U5_MOUSE
Katanin p60 ATPase-containing subun...
Katnal2
277Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z087D3Z087_MOUSE
Katanin p60 ATPase-containing subun...
Katnal2
85Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RI39D6RI39_MOUSE
Katanin p60 ATPase-containing subun...
Katnal2
39Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_033524150 – 151Missing in isoform 2. 1 Publication2
Alternative sequenceiVSP_033525185 – 219GQIID…DPSER → VSGAQGPRMERGTCLKKKEN KAYSCCQTGKRRQKH in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_033526220 – 539Missing in isoform 2. 1 PublicationAdd BLAST320
Alternative sequenceiVSP_033527407 – 409LDC → GDA in isoform 3. 1 Publication3
Alternative sequenceiVSP_033528410 – 539Missing in isoform 3. 1 PublicationAdd BLAST130

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK017114 mRNA Translation: BAB30604.1
AC132608 Genomic DNA No translation available.
BC069977 mRNA Translation: AAH69977.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS37865.1 [Q9D3R6-3]
CCDS89281.1 [Q9D3R6-1]

NCBI Reference Sequences

More...RefSeqi		NP_081997.1, NM_027721.2 [Q9D3R6-3]
XP_006526500.1, XM_006526437.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000026486; ENSMUSP00000026486; ENSMUSG00000025420 [Q9D3R6-3]
ENSMUST00000126153; ENSMUSP00000122079; ENSMUSG00000025420 [Q9D3R6-1]
ENSMUST00000154665; ENSMUSP00000119066; ENSMUSG00000025420 [Q9D3R6-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		71206

UCSC genome browser

More...UCSCi		uc008fqx.1, mouse [Q9D3R6-3]
uc008fqz.1, mouse [Q9D3R6-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK017114 mRNA Translation: BAB30604.1
AC132608 Genomic DNA No translation available.
BC069977 mRNA Translation: AAH69977.1
CCDSiCCDS37865.1 [Q9D3R6-3]
CCDS89281.1 [Q9D3R6-1]
RefSeqiNP_081997.1, NM_027721.2 [Q9D3R6-3]
XP_006526500.1, XM_006526437.3

3D structure databases

SMRiQ9D3R6
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000026486

PTM databases

iPTMnetiQ9D3R6
PhosphoSitePlusiQ9D3R6

Proteomic databases

jPOSTiQ9D3R6
PaxDbiQ9D3R6
PRIDEiQ9D3R6

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		22528, 57 antibodies

Genome annotation databases

EnsembliENSMUST00000026486; ENSMUSP00000026486; ENSMUSG00000025420 [Q9D3R6-3]
ENSMUST00000126153; ENSMUSP00000122079; ENSMUSG00000025420 [Q9D3R6-1]
ENSMUST00000154665; ENSMUSP00000119066; ENSMUSG00000025420 [Q9D3R6-2]
GeneIDi71206
UCSCiuc008fqx.1, mouse [Q9D3R6-3]
uc008fqz.1, mouse [Q9D3R6-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		83473
MGIiMGI:1924234, Katnal2

Phylogenomic databases

eggNOGiKOG0738, Eukaryota
GeneTreeiENSGT00940000157302
HOGENOMiCLU_000688_21_1_1
InParanoidiQ9D3R6
OrthoDBi787710at2759
PhylomeDBiQ9D3R6
TreeFamiTF329610

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		71206, 0 hits in 12 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Katnal2, mouse

Protein Ontology

More...PROi		PR:Q9D3R6
RNActiQ9D3R6, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000025420, Expressed in spermatid and 148 other tissues
ExpressionAtlasiQ9D3R6, baseline and differential
GenevisibleiQ9D3R6, MM

Family and domain databases

HAMAPiMF_03025, Katanin_p60_AL2, 1 hit
InterProiView protein in InterPro
IPR003593, AAA+_ATPase
IPR041569, AAA_lid_3
IPR003959, ATPase_AAA_core
IPR027497, Katanin_p60_AL2
IPR006594, LisH
IPR027417, P-loop_NTPase
PfamiView protein in Pfam
PF00004, AAA, 1 hit
PF17862, AAA_lid_3, 1 hit
PF08513, LisH, 1 hit
SMARTiView protein in SMART
SM00382, AAA, 1 hit
SM00667, LisH, 1 hit
SUPFAMiSSF52540, SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50896, LISH, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKATL2_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9D3R6
Secondary accession number(s): Q6NSQ2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 20, 2008
Last modified: December 2, 2020
This is version 146 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again