Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 119 (16 Oct 2019)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein tweety homolog 1

Gene

Ttyh1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable chloride channel. May be involved in cell adhesion (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChloride channel, Ion channel
Biological processCell adhesion, Ion transport, Transport
LigandChloride

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-2672351 Stimuli-sensing channels

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein tweety homolog 1
Short name:
mTTY1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ttyh1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1889007 Ttyh1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 43ExtracellularSequence analysisAdd BLAST43
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei44 – 64Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini65 – 88CytoplasmicSequence analysisAdd BLAST24
Transmembranei89 – 109Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini110 – 214ExtracellularSequence analysisAdd BLAST105
Transmembranei215 – 235Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini236 – 240CytoplasmicSequence analysis5
Transmembranei241 – 261Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini262 – 390ExtracellularSequence analysisAdd BLAST129
Transmembranei391 – 411Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini412 – 450CytoplasmicSequence analysisAdd BLAST39

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003122411 – 450Protein tweety homolog 1Add BLAST450

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi130N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi284N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi355N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei440PhosphoserineCombined sources1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9D3A9

PeptideAtlas

More...
PeptideAtlasi
Q9D3A9

PRoteomics IDEntifications database

More...
PRIDEi
Q9D3A9

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9D3A9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9D3A9

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9D3A9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Restricted mainly to neural tissues. Strongly expressed in brain and eye.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000030428 Expressed in 235 organ(s), highest expression level in visual cortex

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9D3A9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9D3A9 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q9D3A9, 2 interactors

Molecular INTeraction database

More...
MINTi
Q9D3A9

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000078384

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi424 – 433Poly-Asp10

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the tweety family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4433 Eukaryota
ENOG410ZNTN LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183060

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9D3A9

KEGG Orthology (KO)

More...
KOi
K22641

Identification of Orthologs from Complete Genome Data

More...
OMAi
SYSPSIW

Database of Orthologous Groups

More...
OrthoDBi
725378at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9D3A9

TreeFam database of animal gene trees

More...
TreeFami
TF319025

Family and domain databases

Conserved Domains Database

More...
CDDi
cd07912 Tweety_N, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR006990 Tweety

The PANTHER Classification System

More...
PANTHERi
PTHR12424 PTHR12424, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04906 Tweety, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9D3A9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGAPPGYRPS AWVHLLHQLP RADFQLRPVP SGFAPRDQEY QQALLLVAAL
60 70 80 90 100
AGLGLGLSLI FIAVYLIRFC CCRPPEPHGA KSPPPGGGCV TWSCIAALLV
110 120 130 140 150
GCAGIGIGFY GNSETSDGVS QLSSALLHAN HTLSTIDDVV LETVERLGEA
160 170 180 190 200
VKTELTTLEE VLSVRMELVA ATRGARRQAE AAAQYLQGLA FWQGVSLSPV
210 220 230 240 250
QVAEDVTFVE EYRWLAYVLL LLLVLLVCLF TLLGLAKQSK WLVVVMTAMS
260 270 280 290 300
LLVLVLSWGS MGLEAATAVG LSDFCSNPDT YVLNLTQEET GLSSDILSYY
310 320 330 340 350
FLCNQAVSNP FQQRLTLSQR ALASIHSQLQ GLEREAIPQF SAAQKPLLSL
360 370 380 390 400
EETLNVTERS FHQLVALLHC RSLHKDYGSA LRGLCEDALE GLLFLMLFSL
410 420 430 440 450
LSAGALATTL CSLPRAWALF PPSDDYDDTD DDDPFNPQES KRFVQWQSSI
Length:450
Mass (Da):49,032
Last modified:June 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i53A93E0EC7D16EB8
GO
Isoform 4 (identifier: Q9D3A9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     423-450: SDDYDDTDDDDPFNPQESKRFVQWQSSI → RNPNALCSGSLPSEPPLQSGACLSSMLLSWLLEKAPLT

Note: PubMed:15010458 (BAD20188) sequence has a frameshift in position 445. No experimental confirmation available.
Show »
Length:460
Mass (Da):49,665
Checksum:i52D95C15B8EA2312
GO
Isoform 5 (identifier: Q9D3A9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-96: Missing.
     97-102: ALLVGC → MQRSNS

Note: No experimental confirmation available.
Show »
Length:354
Mass (Da):38,905
Checksum:i006EC0B35F79C8C0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0U1RPU8A0A0U1RPU8_MOUSE
Protein tweety homolog
Ttyh1
354Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RG66D6RG66_MOUSE
Protein tweety homolog
Ttyh1
113Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G8JL37G8JL37_MOUSE
Protein tweety homolog
Ttyh1
103Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RPY1A0A0U1RPY1_MOUSE
Protein tweety homolog
Ttyh1
108Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAG15842 differs from that shown. Aberrant splicing.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti15L → P in AAG02615 (PubMed:10950931).Curated1
Sequence conflicti15L → P in AAG15842 (PubMed:10950931).Curated1
Sequence conflicti21R → L in BAC31730 (PubMed:16141072).Curated1
Sequence conflicti116S → T in BAB29865 (PubMed:16141072).Curated1
Sequence conflicti151V → M in BAB29865 (PubMed:16141072).Curated1
Sequence conflicti288E → G in AAG02615 (PubMed:10950931).Curated1
Sequence conflicti288E → G in AAG15842 (PubMed:10950931).Curated1
Sequence conflicti288E → G in BAD20188 (PubMed:15010458).Curated1
Sequence conflicti427D → Y in BAB29865 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0297621 – 96Missing in isoform 5. 1 PublicationAdd BLAST96
Alternative sequenceiVSP_02976397 – 102ALLVGC → MQRSNS in isoform 5. 1 Publication6
Alternative sequenceiVSP_029765423 – 450SDDYD…WQSSI → RNPNALCSGSLPSEPPLQSG ACLSSMLLSWLLEKAPLT in isoform 4. 2 PublicationsAdd BLAST28

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF190991 mRNA Translation: AAG15842.1 Sequence problems.
AF190699 mRNA Translation: AAG02615.1
DQ104403 Genomic DNA Translation: AAZ06803.1
AB162929 mRNA Translation: BAD20188.1 Frameshift.
AK015486 mRNA Translation: BAB29865.1
AK018148 mRNA Translation: BAB31094.1
AK043998 mRNA Translation: BAC31730.1
AK048413 mRNA Translation: BAC33329.1
AK049903 mRNA Translation: BAC33980.1
BC046310 mRNA Translation: AAH46310.1
BC065694 mRNA Translation: AAH65694.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS20730.1 [Q9D3A9-1]
CCDS51970.1 [Q9D3A9-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001001454.2, NM_001001454.4 [Q9D3A9-4]
NP_001103235.1, NM_001109765.2 [Q9D3A9-1]
NP_001292751.1, NM_001305822.1
NP_067299.2, NM_021324.6 [Q9D3A9-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000079415; ENSMUSP00000078384; ENSMUSG00000030428 [Q9D3A9-4]
ENSMUST00000119661; ENSMUSP00000113937; ENSMUSG00000030428 [Q9D3A9-1]
ENSMUST00000129423; ENSMUSP00000120182; ENSMUSG00000030428 [Q9D3A9-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57776

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:57776

UCSC genome browser

More...
UCSCi
uc009eww.3 mouse [Q9D3A9-1]
uc012ewq.2 mouse [Q9D3A9-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF190991 mRNA Translation: AAG15842.1 Sequence problems.
AF190699 mRNA Translation: AAG02615.1
DQ104403 Genomic DNA Translation: AAZ06803.1
AB162929 mRNA Translation: BAD20188.1 Frameshift.
AK015486 mRNA Translation: BAB29865.1
AK018148 mRNA Translation: BAB31094.1
AK043998 mRNA Translation: BAC31730.1
AK048413 mRNA Translation: BAC33329.1
AK049903 mRNA Translation: BAC33980.1
BC046310 mRNA Translation: AAH46310.1
BC065694 mRNA Translation: AAH65694.1
CCDSiCCDS20730.1 [Q9D3A9-1]
CCDS51970.1 [Q9D3A9-4]
RefSeqiNP_001001454.2, NM_001001454.4 [Q9D3A9-4]
NP_001103235.1, NM_001109765.2 [Q9D3A9-1]
NP_001292751.1, NM_001305822.1
NP_067299.2, NM_021324.6 [Q9D3A9-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

IntActiQ9D3A9, 2 interactors
MINTiQ9D3A9
STRINGi10090.ENSMUSP00000078384

PTM databases

iPTMnetiQ9D3A9
PhosphoSitePlusiQ9D3A9
SwissPalmiQ9D3A9

Proteomic databases

PaxDbiQ9D3A9
PeptideAtlasiQ9D3A9
PRIDEiQ9D3A9

Genome annotation databases

EnsembliENSMUST00000079415; ENSMUSP00000078384; ENSMUSG00000030428 [Q9D3A9-4]
ENSMUST00000119661; ENSMUSP00000113937; ENSMUSG00000030428 [Q9D3A9-1]
ENSMUST00000129423; ENSMUSP00000120182; ENSMUSG00000030428 [Q9D3A9-1]
GeneIDi57776
KEGGimmu:57776
UCSCiuc009eww.3 mouse [Q9D3A9-1]
uc012ewq.2 mouse [Q9D3A9-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57348
MGIiMGI:1889007 Ttyh1

Phylogenomic databases

eggNOGiKOG4433 Eukaryota
ENOG410ZNTN LUCA
GeneTreeiENSGT00950000183060
InParanoidiQ9D3A9
KOiK22641
OMAiSYSPSIW
OrthoDBi725378at2759
PhylomeDBiQ9D3A9
TreeFamiTF319025

Enzyme and pathway databases

ReactomeiR-MMU-2672351 Stimuli-sensing channels

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Ttyh1 mouse

Protein Ontology

More...
PROi
PR:Q9D3A9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000030428 Expressed in 235 organ(s), highest expression level in visual cortex
ExpressionAtlasiQ9D3A9 baseline and differential
GenevisibleiQ9D3A9 MM

Family and domain databases

CDDicd07912 Tweety_N, 1 hit
InterProiView protein in InterPro
IPR006990 Tweety
PANTHERiPTHR12424 PTHR12424, 1 hit
PfamiView protein in Pfam
PF04906 Tweety, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTTYH1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9D3A9
Secondary accession number(s): Q6L751
, Q6P0A7, Q8BRL4, Q8C7M4, Q9D5D1, Q9EQN7, Q9ESC3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: June 1, 2001
Last modified: October 16, 2019
This is version 119 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again