Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Low molecular weight phosphotyrosine protein phosphatase

Gene

Acp1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates.By similarity

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.By similarity
A phosphate monoester + H2O = an alcohol + phosphate.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei13NucleophileBy similarity1
Active sitei19By similarity1
Active sitei130Proton donorBy similarity1

GO - Molecular functioni

Keywordsi

Molecular functionHydrolase, Protein phosphatase

Names & Taxonomyi

Protein namesi
Recommended name:
Low molecular weight phosphotyrosine protein phosphatase (EC:3.1.3.48)
Short name:
LMW-PTP
Short name:
LMW-PTPase
Alternative name(s):
Low molecular weight cytosolic acid phosphatase (EC:3.1.3.2)
Gene namesi
Name:Acp1
OrganismiMus musculus (Mouse)Imported
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 12

Organism-specific databases

MGIiMGI:87881 Acp1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Chemistry databases

ChEMBLiCHEMBL3593153

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00000465592 – 158Low molecular weight phosphotyrosine protein phosphataseAdd BLAST157

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineBy similarity1
Modified residuei132PhosphotyrosineBy similarity1
Modified residuei133PhosphotyrosineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ9D358
PeptideAtlasiQ9D358
PRIDEiQ9D358

2D gel databases

REPRODUCTION-2DPAGEiQ9D358

PTM databases

iPTMnetiQ9D358
PhosphoSitePlusiQ9D358

Expressioni

Tissue specificityi

Widely expressed with highest levels in brain and liver and lowest levels in muscle.1 Publication

Gene expression databases

BgeeiENSMUSG00000044573 Expressed in 184 organ(s), highest expression level in thymus primordium
CleanExiMM_ACP1
ExpressionAtlasiQ9D358 baseline and differential
GenevisibleiQ9D358 MM

Interactioni

Subunit structurei

Interacts with the SH3 domain of SPTAN1. Interacts with EPHA2; dephosphorylates EPHA2. Interacts with EPHB1 (By similarity).By similarity

Protein-protein interaction databases

BioGridi197927, 4 interactors
IntActiQ9D358, 4 interactors
MINTiQ9D358

Chemistry databases

BindingDBiQ9D358

Structurei

Secondary structure

1158
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ9D358
SMRiQ9D358
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

GeneTreeiENSGT00500000044891
HOGENOMiHOG000273094
HOVERGENiHBG007540
InParanoidiQ9D358
KOiK14394
PhylomeDBiQ9D358
TreeFamiTF353727

Family and domain databases

InterProiView protein in InterPro
IPR023485 Ptyr_pPase
IPR036196 Ptyr_pPase_sf
IPR002115 Tyr_Pase_low_mol_wt_mml
IPR017867 Tyr_phospatase_low_mol_wt
PfamiView protein in Pfam
PF01451 LMWPc, 1 hit
PRINTSiPR00719 LMWPTPASE
PR00720 MAMMALPTPASE
SMARTiView protein in SMART
SM00226 LMWPc, 1 hit
SUPFAMiSSF52788 SSF52788, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: Q9D358-1) [UniParc]FASTAAdd to basket
Also known as: m-IF11 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEVGSKSVL FVCLGNICRS PIAEAVFRKL VTDEKVSDNW RIDSAATSTY
60 70 80 90 100
EVGNPPDYRG QNCMRKHGIH MQHIARQITK EDFATFDYIL CMDESNLRDL
110 120 130 140 150
NRKSNQVKNC KAKIELLGSY DPQKQLIIED PYYGNDSDFE VVYQQCLRCC

KAFLEKTY
Length:158
Mass (Da):18,192
Last modified:January 23, 2007 - v3
Checksum:iA374BE5C183226AE
GO
Isoform 21 Publication (identifier: Q9D358-2) [UniParc]FASTAAdd to basket
Also known as: m-IF21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     41-74: RIDSAATSTYEVGNPPDYRGQNCMRKHGIHMQHI → AIDSSAVSDWNVGRPPDPRAVSCLRNRGISTAHK

Show »
Length:158
Mass (Da):17,941
Checksum:iA2A1AF4BF774889E
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q561M1Q561M1_MOUSE
Acp1 protein
Acp1 mCG_7808
158Annotation score:
A0A1W2P7X3A0A1W2P7X3_MOUSE
Low molecular weight phosphotyrosin...
Acp1
114Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural varianti14L → P1 Publication1
Natural varianti157T → P1 Publication1
Isoform 21 Publication (identifier: Q9D358-2)
Natural varianti67R → H. 1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05072641 – 74RIDSA…HMQHI → AIDSSAVSDWNVGRPPDPRA VSCLRNRGISTAHK in isoform 2. 3 PublicationsAdd BLAST34

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y17343 mRNA Translation: CAA76753.1
Y17344 mRNA Translation: CAA76754.1
Y17345 mRNA Translation: CAA76755.1
AK014603 mRNA Translation: BAB29458.1
AK018329 mRNA Translation: BAB31164.1
AK019186 mRNA Translation: BAB31593.1
AK082955 mRNA Translation: BAC38707.1
BC039744 mRNA Translation: AAH39744.1
CCDSiCCDS36427.1 [Q9D358-1]
CCDS49045.1 [Q9D358-2]
RefSeqiNP_001103709.1, NM_001110239.1
NP_067305.2, NM_021330.4 [Q9D358-1]
UniGeneiMm.359831

Genome annotation databases

EnsembliENSMUST00000062740; ENSMUSP00000106509; ENSMUSG00000044573 [Q9D358-1]
GeneIDi11431
KEGGimmu:11431
UCSCiuc007ngw.2 mouse [Q9D358-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y17343 mRNA Translation: CAA76753.1
Y17344 mRNA Translation: CAA76754.1
Y17345 mRNA Translation: CAA76755.1
AK014603 mRNA Translation: BAB29458.1
AK018329 mRNA Translation: BAB31164.1
AK019186 mRNA Translation: BAB31593.1
AK082955 mRNA Translation: BAC38707.1
BC039744 mRNA Translation: AAH39744.1
CCDSiCCDS36427.1 [Q9D358-1]
CCDS49045.1 [Q9D358-2]
RefSeqiNP_001103709.1, NM_001110239.1
NP_067305.2, NM_021330.4 [Q9D358-1]
UniGeneiMm.359831

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2P4UX-ray1.90A/B/C/D2-158[»]
5JNUX-ray2.54A/B1-158[»]
ProteinModelPortaliQ9D358
SMRiQ9D358
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi197927, 4 interactors
IntActiQ9D358, 4 interactors
MINTiQ9D358

Chemistry databases

BindingDBiQ9D358
ChEMBLiCHEMBL3593153

PTM databases

iPTMnetiQ9D358
PhosphoSitePlusiQ9D358

2D gel databases

REPRODUCTION-2DPAGEiQ9D358

Proteomic databases

EPDiQ9D358
PeptideAtlasiQ9D358
PRIDEiQ9D358

Protocols and materials databases

DNASUi11431
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000062740; ENSMUSP00000106509; ENSMUSG00000044573 [Q9D358-1]
GeneIDi11431
KEGGimmu:11431
UCSCiuc007ngw.2 mouse [Q9D358-1]

Organism-specific databases

CTDi52
MGIiMGI:87881 Acp1

Phylogenomic databases

GeneTreeiENSGT00500000044891
HOGENOMiHOG000273094
HOVERGENiHBG007540
InParanoidiQ9D358
KOiK14394
PhylomeDBiQ9D358
TreeFamiTF353727

Miscellaneous databases

PROiPR:Q9D358
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000044573 Expressed in 184 organ(s), highest expression level in thymus primordium
CleanExiMM_ACP1
ExpressionAtlasiQ9D358 baseline and differential
GenevisibleiQ9D358 MM

Family and domain databases

InterProiView protein in InterPro
IPR023485 Ptyr_pPase
IPR036196 Ptyr_pPase_sf
IPR002115 Tyr_Pase_low_mol_wt_mml
IPR017867 Tyr_phospatase_low_mol_wt
PfamiView protein in Pfam
PF01451 LMWPc, 1 hit
PRINTSiPR00719 LMWPTPASE
PR00720 MAMMALPTPASE
SMARTiView protein in SMART
SM00226 LMWPc, 1 hit
SUPFAMiSSF52788 SSF52788, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPPAC_MOUSE
AccessioniPrimary (citable) accession number: Q9D358
Secondary accession number(s): O88739, O88740, Q9QWF5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: January 23, 2007
Last modified: October 10, 2018
This is version 142 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again