Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 145 (23 Feb 2022)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Add a publicationFeedback
Protein

Adenylate kinase 7

Gene

Ak7

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Nucleoside monophosphate (NMP) kinase that catalyzes the reversible transfer of the terminal phosphate group between nucleoside triphosphates and monophosphates. Has highest activity toward AMP, and weaker activity toward dAMP, CMP and dCMP. Also displays broad nucleoside diphosphate kinase activity. Involved in maintaining ciliary structure and function.

1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei380AMPBy similarity1
Binding sitei446AMPBy similarity1
Binding sitei478ATP; via carbonyl oxygenBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi268 – 273ATPBy similarity6
Nucleotide bindingi323 – 346AMPBy similarityAdd BLAST24
Nucleotide bindingi373 – 376AMPBy similarity4

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Transferase
Biological processCilium biogenesis/degradation
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-499943, Interconversion of nucleotide di- and triphosphates

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Adenylate kinase 7 (EC:2.7.4.3By similarity, EC:2.7.4.6By similarity)
Short name:
AK 7
Alternative name(s):
ATP-AMP transphosphorylase 7
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ak7
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1926051, Ak7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Flagellum

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mutant mice present pathological signs characteristic of primary ciliary dyskinesia (PCD), including high prevalence of microtubular defects, significantly decreased ciliary beat frequency, hydrocephalus, abnormal spermatogenesis, mucus accumulation in the paranasal passages, and exacerbated respiratory responses upon allergen challenge. This phenotype arose serendipitously in the process of generating transgenic mice harboring a heme oxygenase 1 construct, due to the serendipitous disruption of Ak7 locus by the transgene insertion event (PubMed:18776131). Mutant testes reveal the absence of flagellum structures, compared with those from control littermates. In mutant testes, nearly all sperm heads are attached to cytoplasmic mass and not prolonged by flagellar structures, such as mitochondrial sheath, fibrous sheath and axoneme. In mutant epididymes, very few sperm structures are observed. The rare sperm flagellum observed show an absence of the central pair of microtubules (PubMed:29365104).2 Publications

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001589541 – 614Adenylate kinase 7Add BLAST614

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9D2H2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9D2H2

PRoteomics IDEntifications database

More...
PRIDEi
Q9D2H2

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
269240 [Q9D2H2-2]
269241 [Q9D2H2-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9D2H2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9D2H2

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
219643, 2 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000043145

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9D2H2, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9D2H2

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni258 – 503Adenylate kinaseBy similarityAdd BLAST246
Regioni288 – 346NMPBy similarityAdd BLAST59
Regioni308 – 327DisorderedSequence analysisAdd BLAST20
Regioni428 – 438LIDBy similarityAdd BLAST11
Regioni570 – 614DPY-30By similarityAdd BLAST45

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili376 – 568Sequence analysisAdd BLAST193

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi311 – 327Acidic residuesSequence analysisAdd BLAST17

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

In the central section; belongs to the adenylate kinase family.Curated
In the C-terminal section; belongs to the dpy-30 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3078, Eukaryota

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9D2H2

Identification of Orthologs from Complete Genome Data

More...
OMAi
NECKFRG

Database of Orthologous Groups

More...
OrthoDBi
572856at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9D2H2

Family and domain databases

Conserved Domains Database

More...
CDDi
cd01428, ADK, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.300, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000850, Adenylat/UMP-CMP_kin
IPR026867, AK7
IPR007858, Dpy-30_motif
IPR036291, NAD(P)-bd_dom_sf
IPR027417, P-loop_NTPase

The PANTHER Classification System

More...
PANTHERi
PTHR23359, PTHR23359, 1 hit
PTHR23359:SF105, PTHR23359:SF105, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05186, Dpy-30, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF51735, SSF51735, 1 hit
SSF52540, SSF52540, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9D2H2-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MECDAVIYNI TENVQQVEEA LWAVSALNEE ISHFEKRKVF ILLSTVMTWA
60 70 80 90 100
RSKPLDPDDN EVPFTEEDYR RRKHHPNFLD HINAEKIVLK FGKNAKKFAT
110 120 130 140 150
YVVASGLQYG AEGGILHTFF KMAWLGEVPA LPVFGDGTNC IPAIHVVDLA
160 170 180 190 200
GVIQNIIDHV PKLHYLVAVD EAVHTLEDLV KCISKNTGPG KIQKVPKENA
210 220 230 240 250
FLTKDLTQEY LDHLLVNLRM EALFVKENFN IRWVAQTGFV ENINSILKEY
260 270 280 290 300
KQSRGLLPIK ICILGPPAVG KSSISEELAK YYKLHHIKMK DVIAEAIAKL
310 320 330 340 350
EAIVAPKDSV EGEEEGEEEE EEENVDDAQE LLDGIKESME QNAGRLEDQY
360 370 380 390 400
IIRFVKEKLK SMPCRNQGFI LDGFPKTYDQ AKDLFNQEEE EEEEEIRGKI
410 420 430 440 450
FPYDKLITPE FVCGLDASDE FLKERVMNLP ESVVAGTHYS QDRFLRSLSH
460 470 480 490 500
YRDINTDDET VFNYFDELEI HPIHIDVGKL EDAQNRLAIK QLIKEIGKPR
510 520 530 540 550
NYGLTDEEKA EEEKKAAEER LAKEAAQTAE LEHKEAMEMA EKIARWEEWN
560 570 580 590 600
KRLEEVKREE RELLEVQSVP LRNYLMTYVM PTLMQGLNEC CKVRPEDPVD
610
FLAEYLFKNN PEMQ
Length:614
Mass (Da):70,675
Last modified:June 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0ABA0DC6C7CE5E8B
GO
Isoform 2 (identifier: Q9D2H2-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-57: MECDAVIYNITENVQQVEEALWAVSALNEEISHFEKRKVFILLSTVMTWARSKPLDP → M
     181-206: KCISKNTGPGKIQKVPKENAFLTKDL → KVCVLTPCRASLSSCTLWMLVTDFLC
     207-614: Missing.

Show »
Length:150
Mass (Da):16,734
Checksum:i758CF854E92D94B1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WIC0F8WIC0_MOUSE
Nucleoside-diphosphate kinase
Ak7
723Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0084741 – 57MECDA…KPLDP → M in isoform 2. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_008475181 – 206KCISK…LTKDL → KVCVLTPCRASLSSCTLWML VTDFLC in isoform 2. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_008476207 – 614Missing in isoform 2. 1 PublicationAdd BLAST408

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK019664 mRNA Translation: BAB31828.1
AK078221 mRNA Translation: BAC37180.1

NCBI Reference Sequences

More...
RefSeqi
NP_084463.1, NM_030187.1

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
78801

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:78801

UCSC genome browser

More...
UCSCi
uc007oyu.1, mouse [Q9D2H2-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK019664 mRNA Translation: BAB31828.1
AK078221 mRNA Translation: BAC37180.1
RefSeqiNP_084463.1, NM_030187.1

3D structure databases

SMRiQ9D2H2
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi219643, 2 interactors
STRINGi10090.ENSMUSP00000043145

PTM databases

iPTMnetiQ9D2H2
PhosphoSitePlusiQ9D2H2

Proteomic databases

MaxQBiQ9D2H2
PaxDbiQ9D2H2
PRIDEiQ9D2H2
ProteomicsDBi269240 [Q9D2H2-2]
269241 [Q9D2H2-1]

Genome annotation databases

GeneIDi78801
KEGGimmu:78801
UCSCiuc007oyu.1, mouse [Q9D2H2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
122481
MGIiMGI:1926051, Ak7

Phylogenomic databases

eggNOGiKOG3078, Eukaryota
InParanoidiQ9D2H2
OMAiNECKFRG
OrthoDBi572856at2759
PhylomeDBiQ9D2H2

Enzyme and pathway databases

ReactomeiR-MMU-499943, Interconversion of nucleotide di- and triphosphates

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
78801, 0 hits in 66 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Ak7, mouse

Protein Ontology

More...
PROi
PR:Q9D2H2
RNActiQ9D2H2, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Family and domain databases

CDDicd01428, ADK, 1 hit
Gene3Di3.40.50.300, 1 hit
InterProiView protein in InterPro
IPR000850, Adenylat/UMP-CMP_kin
IPR026867, AK7
IPR007858, Dpy-30_motif
IPR036291, NAD(P)-bd_dom_sf
IPR027417, P-loop_NTPase
PANTHERiPTHR23359, PTHR23359, 1 hit
PTHR23359:SF105, PTHR23359:SF105, 1 hit
PfamiView protein in Pfam
PF05186, Dpy-30, 1 hit
SUPFAMiSSF51735, SSF51735, 1 hit
SSF52540, SSF52540, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKAD7_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9D2H2
Secondary accession number(s): Q8BVH3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 3, 2003
Last sequence update: June 1, 2001
Last modified: February 23, 2022
This is version 145 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again