Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Synaptojanin-2

Gene

Synj2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Inositol 5-phosphatase which may be involved in distinct membrane trafficking and signal transduction pathways. May mediate the inhibitory effect of Rac1 on endocytosis (By similarity).By similarity1 Publication

Catalytic activityi

1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1-phosphatidyl-1D-myo-inositol 4-phosphate + phosphate.1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionHydrolase, RNA-binding

Enzyme and pathway databases

ReactomeiR-MMU-1660499 Synthesis of PIPs at the plasma membrane
R-MMU-8856828 Clathrin-mediated endocytosis

Names & Taxonomyi

Protein namesi
Recommended name:
Synaptojanin-2 (EC:3.1.3.361 Publication)
Alternative name(s):
Synaptic inositol 1,4,5-trisphosphate 5-phosphatase 2
Gene namesi
Name:Synj2
Synonyms:Kiaa0348
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 17

Organism-specific databases

MGIiMGI:1201671 Synj2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002097341 – 1434Synaptojanin-2Add BLAST1434

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1077PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9D2G5
PeptideAtlasiQ9D2G5
PRIDEiQ9D2G5

PTM databases

iPTMnetiQ9D2G5
PhosphoSitePlusiQ9D2G5

Expressioni

Tissue specificityi

Ubiquitously expressed, with the highest levels in heart and brain. Detected in cortex, cerebellum and olfactory bulb. Expressed in the testis.2 Publications

Gene expression databases

BgeeiENSMUSG00000023805 Expressed in 215 organ(s), highest expression level in lumbar subsegment of spinal cord
CleanExiMM_SYNJ2
ExpressionAtlasiQ9D2G5 baseline and differential
GenevisibleiQ9D2G5 MM

Interactioni

Subunit structurei

Binds GRB2 and OMP25.By similarity

GO - Molecular functioni

Protein-protein interaction databases

IntActiQ9D2G5, 1 interactor
STRINGi10090.ENSMUSP00000111457

Structurei

3D structure databases

ProteinModelPortaliQ9D2G5
SMRiQ9D2G5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini120 – 444SACPROSITE-ProRule annotationAdd BLAST325
Domaini889 – 968RRMPROSITE-ProRule annotationAdd BLAST80

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni450 – ?CatalyticBy similarity

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi1144 – 1281Pro-richAdd BLAST138

Domaini

The C-terminal proline-rich region mediates binding to the SH3 domain-containing protein GRB2.

Sequence similaritiesi

Belongs to the synaptojanin family.Curated
In the central section; belongs to the inositol 1,4,5-trisphosphate 5-phosphatase family.Curated

Phylogenomic databases

eggNOGiKOG0566 Eukaryota
COG5329 LUCA
COG5411 LUCA
GeneTreeiENSGT00760000119075
HOVERGENiHBG079225
InParanoidiQ9D2G5
KOiK20279
PhylomeDBiQ9D2G5
TreeFamiTF354311

Family and domain databases

CDDicd12720 RRM_SYNJ2, 1 hit
Gene3Di3.30.70.330, 1 hit
3.60.10.10, 1 hit
InterProiView protein in InterPro
IPR015047 DUF1866
IPR036691 Endo/exonu/phosph_ase_sf
IPR005135 Endo/exonuclease/phosphatase
IPR000300 IPPc
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
IPR002013 SAC_dom
IPR034974 SYNJ2
IPR034973 SYNJ2_RRM
PANTHERiPTHR11200:SF148 PTHR11200:SF148, 2 hits
PfamiView protein in Pfam
PF08952 DUF1866, 1 hit
PF03372 Exo_endo_phos, 1 hit
PF02383 Syja_N, 1 hit
SMARTiView protein in SMART
SM01165 DUF1866, 1 hit
SM00128 IPPc, 1 hit
SUPFAMiSSF54928 SSF54928, 1 hit
SSF56219 SSF56219, 1 hit
PROSITEiView protein in PROSITE
PS50102 RRM, 1 hit
PS50275 SAC, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9D2G5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALSKGLRLL ARLDPTGPSS VLLEARGRGD CLLFEAGAVA TLAPEEKEVI
60 70 80 90 100
KGLYSKLTDA YGCLGELRLQ SGGVPLSFLV LVTGCMSVGR IPDAEIYKIT
110 120 130 140 150
ATELYPLQEE AKEEDRLPTL KKILSSGVFY FAWPNDGACF DLTIRAQKQG
160 170 180 190 200
DDGSEWGTSF FWNQLLHVPL RQHQVNCHNW LLKVICGVVT IRTVYASHKQ
210 220 230 240 250
AKACLISRIS CERAGARFLT RGVNDDGHVS NFVETEQTIY MDDGVSSFVQ
260 270 280 290 300
IRGSVPLFWE QPGLQVGSHH LRLHRGLEAN APAFERHMVL LKEQYGKQVV
310 320 330 340 350
VNLLGSRGGE EVLNRAFKKL LWASCHAGDT PMINFDFHQF AKGRKLEKLE
360 370 380 390 400
NLLRPQLQLH WEDFGVFAKG ENVSPRFQKG TLRMNCLDCL DRTNTVQCFI
410 420 430 440 450
ALEVLHLQLE SLGLNSKPII DRFVESFKAM WSLNGHSLSK VFTGSRALEG
460 470 480 490 500
KAKVGKLKDG ARSMSRTIQS NFFDGVKQEA IKLLLVGDVY NEESTDKGRM
510 520 530 540 550
LLDNTALLAT PRILKAMTER QSEFTNFKRI QIAVGTWNVN GGKQFRSNLL
560 570 580 590 600
GTAELTDWLL DAPQLSGAVD SQDDGSPADV FAIGFEEMVE LSAGNIVNAS
610 620 630 640 650
TTNRKMWGEQ LQKAISRSHR YILLTSAQLV GVCLYIFVRP YHVPFIRDVA
660 670 680 690 700
IDTVKTGMGG KAGNKGAVGI RFQLHSTSFC FVCSHLTAGQ SQVKERNEDY
710 720 730 740 750
REITHKLSFP SGRNIFSHDY VFWCGDFNYR IDLTYEEVFY FVKRQDWKKL
760 770 780 790 800
MEFDQLQLQK SSGKIFKDFH EGAVNFGPTY KYDVGSAAYD TSDKCRTPAW
810 820 830 840 850
TDRVLWWRKK HPYDKTAGEL NLLDSDLDGD PQIRHTWSPG TLKYYGRAEL
860 870 880 890 900
QASDHRPVLA IVEVEVQEVD VGARERVFQE VSSVQGPLDA TVVVNLQSPT
910 920 930 940 950
LEEKNEFPED LRTELMQTLG NYGTIILVRI NQGQMLVTFA DSHSALSVLD
960 970 980 990 1000
VDGMKVKGRA VKIRPKTKDW LEGLREELLR KRDSMAPVSP TANSCLLEEN
1010 1020 1030 1040 1050
FDFSSLDYES EGDVLEEDED YLVDGFGQPV VSDSELGGDN SSDTMSSLTP
1060 1070 1080 1090 1100
ASKSPALAKK KQHPTYKAGL MVKKSASDAS ISSGTHGQYS ILQTAKLLPG
1110 1120 1130 1140 1150
APQQPPKART GISKPYNVKQ IKTTNAQEAE AAIRCLLEAS GGVPESAPGA
1160 1170 1180 1190 1200
IPLRNQGSSK PEATLGPPAL PRRPAPRVPT MKKPTLRRTG KPMLPEENFE
1210 1220 1230 1240 1250
PQPVHFTMAS QEMNLETPPP ITATPIPPVP KPRTLQPGKG VEGRPSSGKP
1260 1270 1280 1290 1300
EPDEAPSVTG TVESPPPEAQ EAPSLAPKVP PRRKKSAPAA FHLQVLQNNS
1310 1320 1330 1340 1350
QVLQGLTCSS SSPPSLKPDT HPLCLQVALG TSSARSPETH GPRVTEPEAA
1360 1370 1380 1390 1400
SFHGNYPDPF WSLLHHPKLL NNTWLSKSSE PLDVGSRNPE RTHTEPAQVN
1410 1420 1430
ASLAERGLPP DHGGKDLSHW VTASNKDKRT TLGV
Length:1,434
Mass (Da):158,480
Last modified:January 16, 2004 - v2
Checksum:i69FE8148A3E91827
GO
Isoform 2 (identifier: Q9D2G5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-85: Missing.

Note: No experimental confirmation available.
Show »
Length:1,349
Mass (Da):149,621
Checksum:i32F9E3FDA32C98EE
GO
Isoform 3 (identifier: Q9D2G5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-316: Missing.
     317-318: FK → MQ
     1106-1434: PKARTGISKP...NKDKRTTLGV → VSPLWGSQGSGQRFRPAGVVLHPKTMWISVDTRNI

Note: No experimental confirmation available.
Show »
Length:824
Mass (Da):92,285
Checksum:iBCE381F62FB82850
GO
Isoform 4 (identifier: Q9D2G5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-161: Missing.
     162-162: W → M

Note: No experimental confirmation available.
Show »
Length:1,273
Mass (Da):140,990
Checksum:iE9ADB182F47FC406
GO
Isoform 5 (identifier: Q9D2G5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1192-1434: PMLPEENFEP...NKDKRTTLGV → VYSGISQCLR...FQDLWLKFRR

Show »
Length:1,256
Mass (Da):140,129
Checksum:i4C6B04FBA36CAF2D
GO
Isoform 6 (identifier: Q9D2G5-6) [UniParc]FASTAAdd to basket
Also known as: 2alpha

The sequence of this isoform differs from the canonical sequence as follows:
     1-85: Missing.
     1068-1068: A → DDAHLVTLKQELEVAGNFRHRSPSRSLSVPNRPRPPHPPQRPPPPT
     1192-1434: PMLPEENFEP...NKDKRTTLGV → VYSGISQCLR...FQDLWLKFRR

Show »
Length:1,216
Mass (Da):136,363
Checksum:i8093BE1D6419C728
GO

Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WHD8F8WHD8_MOUSE
Synaptojanin-2
Synj2
1,479Annotation score:
D3YZB2D3YZB2_MOUSE
Synaptojanin-2
Synj2
1,394Annotation score:
E9Q4P5E9Q4P5_MOUSE
Synaptojanin-2
Synj2
1,118Annotation score:
F6U4I6F6U4I6_MOUSE
Synaptojanin-2
Synj2
384Annotation score:
F7BI35F7BI35_MOUSE
Synaptojanin-2
Synj2
725Annotation score:
D3YWM9D3YWM9_MOUSE
Synaptojanin-2
Synj2
660Annotation score:
D3YZB5D3YZB5_MOUSE
Synaptojanin-2
Synj2
535Annotation score:
S4R207S4R207_MOUSE
Synaptojanin-2
Synj2
84Annotation score:

Sequence cautioni

The sequence AAC33137 differs from that shown. Sequencing errors.Curated
The sequence AAC33137 differs from that shown. Reason: Frameshift at several positions.Curated
The sequence BAC97932 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti571S → Y in BAB31837 (PubMed:16141072).Curated1
Sequence conflicti1013 – 1019DVLEEDE → MFLKRMK in AAC40144 (PubMed:9636665).Curated7

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural varianti263G → R1 Publication1
Natural varianti278E → G1 Publication1
Natural varianti304L → P1 Publication1
Isoform 2 (identifier: Q9D2G5-2)
Natural varianti94N → D. 1
Natural varianti385S → F. 1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0093061 – 316Missing in isoform 3. 1 PublicationAdd BLAST316
Alternative sequenceiVSP_0093051 – 161Missing in isoform 4. 1 PublicationAdd BLAST161
Alternative sequenceiVSP_0093041 – 85Missing in isoform 2 and isoform 6. 2 PublicationsAdd BLAST85
Alternative sequenceiVSP_010563162W → M in isoform 4. 1 Publication1
Alternative sequenceiVSP_009307317 – 318FK → MQ in isoform 3. 1 Publication2
Alternative sequenceiVSP_0093081068A → DDAHLVTLKQELEVAGNFRH RSPSRSLSVPNRPRPPHPPQ RPPPPT in isoform 6. 1 Publication1
Alternative sequenceiVSP_0093091106 – 1434PKART…TTLGV → VSPLWGSQGSGQRFRPAGVV LHPKTMWISVDTRNI in isoform 3. 1 PublicationAdd BLAST329
Alternative sequenceiVSP_0093101192 – 1434PMLPE…TTLGV → VYSGISQCLREELRSAACTP HAVSAQDCGDLNNRWRMPRF SHYIHTKKWKNVSLSFQDLW LKFRR in isoform 5 and isoform 6. 1 PublicationAdd BLAST243

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF041857 mRNA Translation: AAC40141.1
AF041858 mRNA Translation: AAC40142.1
AF041859 mRNA Translation: AAC40143.1
AF041860 mRNA Translation: AAC40144.1
AF041861 mRNA Translation: AAC40145.1
AF041862 mRNA Translation: AAC40146.1
AK129122 mRNA Translation: BAC97932.1 Different initiation.
AK019694 mRNA Translation: BAB31837.1
BC058749 mRNA Translation: AAH58749.1
BC060214 mRNA Translation: AAH60214.1
AF026123 mRNA Translation: AAC33137.1 Sequence problems.
CCDSiCCDS28365.1 [Q9D2G5-6]
CCDS49932.1 [Q9D2G5-1]
PIRiJW0105
PW0050
PW0051
RefSeqiNP_001106822.1, NM_001113351.1
NP_001106823.1, NM_001113352.2 [Q9D2G5-1]
NP_001106824.1, NM_001113353.2
NP_001277627.1, NM_001290698.1
NP_035653.2, NM_011523.2 [Q9D2G5-6]
XP_006523268.1, XM_006523205.3 [Q9D2G5-5]
UniGeneiMm.236068
Mm.483846

Genome annotation databases

EnsembliENSMUST00000061091; ENSMUSP00000060382; ENSMUSG00000023805 [Q9D2G5-6]
ENSMUST00000080283; ENSMUSP00000079164; ENSMUSG00000023805 [Q9D2G5-1]
GeneIDi20975
KEGGimmu:20975
UCSCiuc008afm.3 mouse [Q9D2G5-1]
uc008afp.2 mouse [Q9D2G5-6]
uc008afu.1 mouse [Q9D2G5-3]
uc012ajh.1 mouse [Q9D2G5-5]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF041857 mRNA Translation: AAC40141.1
AF041858 mRNA Translation: AAC40142.1
AF041859 mRNA Translation: AAC40143.1
AF041860 mRNA Translation: AAC40144.1
AF041861 mRNA Translation: AAC40145.1
AF041862 mRNA Translation: AAC40146.1
AK129122 mRNA Translation: BAC97932.1 Different initiation.
AK019694 mRNA Translation: BAB31837.1
BC058749 mRNA Translation: AAH58749.1
BC060214 mRNA Translation: AAH60214.1
AF026123 mRNA Translation: AAC33137.1 Sequence problems.
CCDSiCCDS28365.1 [Q9D2G5-6]
CCDS49932.1 [Q9D2G5-1]
PIRiJW0105
PW0050
PW0051
RefSeqiNP_001106822.1, NM_001113351.1
NP_001106823.1, NM_001113352.2 [Q9D2G5-1]
NP_001106824.1, NM_001113353.2
NP_001277627.1, NM_001290698.1
NP_035653.2, NM_011523.2 [Q9D2G5-6]
XP_006523268.1, XM_006523205.3 [Q9D2G5-5]
UniGeneiMm.236068
Mm.483846

3D structure databases

ProteinModelPortaliQ9D2G5
SMRiQ9D2G5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ9D2G5, 1 interactor
STRINGi10090.ENSMUSP00000111457

PTM databases

iPTMnetiQ9D2G5
PhosphoSitePlusiQ9D2G5

Proteomic databases

PaxDbiQ9D2G5
PeptideAtlasiQ9D2G5
PRIDEiQ9D2G5

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000061091; ENSMUSP00000060382; ENSMUSG00000023805 [Q9D2G5-6]
ENSMUST00000080283; ENSMUSP00000079164; ENSMUSG00000023805 [Q9D2G5-1]
GeneIDi20975
KEGGimmu:20975
UCSCiuc008afm.3 mouse [Q9D2G5-1]
uc008afp.2 mouse [Q9D2G5-6]
uc008afu.1 mouse [Q9D2G5-3]
uc012ajh.1 mouse [Q9D2G5-5]

Organism-specific databases

CTDi8871
MGIiMGI:1201671 Synj2
RougeiSearch...

Phylogenomic databases

eggNOGiKOG0566 Eukaryota
COG5329 LUCA
COG5411 LUCA
GeneTreeiENSGT00760000119075
HOVERGENiHBG079225
InParanoidiQ9D2G5
KOiK20279
PhylomeDBiQ9D2G5
TreeFamiTF354311

Enzyme and pathway databases

ReactomeiR-MMU-1660499 Synthesis of PIPs at the plasma membrane
R-MMU-8856828 Clathrin-mediated endocytosis

Miscellaneous databases

ChiTaRSiSynj2 mouse
PROiPR:Q9D2G5
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000023805 Expressed in 215 organ(s), highest expression level in lumbar subsegment of spinal cord
CleanExiMM_SYNJ2
ExpressionAtlasiQ9D2G5 baseline and differential
GenevisibleiQ9D2G5 MM

Family and domain databases

CDDicd12720 RRM_SYNJ2, 1 hit
Gene3Di3.30.70.330, 1 hit
3.60.10.10, 1 hit
InterProiView protein in InterPro
IPR015047 DUF1866
IPR036691 Endo/exonu/phosph_ase_sf
IPR005135 Endo/exonuclease/phosphatase
IPR000300 IPPc
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
IPR002013 SAC_dom
IPR034974 SYNJ2
IPR034973 SYNJ2_RRM
PANTHERiPTHR11200:SF148 PTHR11200:SF148, 2 hits
PfamiView protein in Pfam
PF08952 DUF1866, 1 hit
PF03372 Exo_endo_phos, 1 hit
PF02383 Syja_N, 1 hit
SMARTiView protein in SMART
SM01165 DUF1866, 1 hit
SM00128 IPPc, 1 hit
SUPFAMiSSF54928 SSF54928, 1 hit
SSF56219 SSF56219, 1 hit
PROSITEiView protein in PROSITE
PS50102 RRM, 1 hit
PS50275 SAC, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSYNJ2_MOUSE
AccessioniPrimary (citable) accession number: Q9D2G5
Secondary accession number(s): O35404
, O88399, O88400, O88401, O88402, O88403, O88404
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 16, 2004
Last sequence update: January 16, 2004
Last modified: November 7, 2018
This is version 150 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again