Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cyclin-dependent kinase 2-interacting protein

Gene

Cinp

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Interacts with the components of the replication complex and 2 kinases, CDK2 and CDC7, thereby providing a functional and physical link between CDK2 and CDC7 during firing of the origins of replication. Regulates ATR-mediated checkpoint signaling (By similarity).By similarity

GO - Biological processi

Keywordsi

Biological processCell cycle, Cell division, DNA damage, DNA repair, DNA replication

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-dependent kinase 2-interacting protein
Gene namesi
Name:Cinp
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 12

Organism-specific databases

MGIiMGI:1914486 Cinp

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003260561 – 212Cyclin-dependent kinase 2-interacting proteinAdd BLAST212

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1
Modified residuei69PhosphoserineBy similarity1
Modified residuei73PhosphoserineBy similarity1

Post-translational modificationi

Phosphorylated by CDC7 but not by CDK2.By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ9D0V8
PRIDEiQ9D0V8

PTM databases

PhosphoSitePlusiQ9D0V8

Expressioni

Gene expression databases

BgeeiENSMUSG00000021276 Expressed in 283 organ(s), highest expression level in urinary bladder
CleanExiMM_2810452K22RIK
ExpressionAtlasiQ9D0V8 baseline and differential
GenevisibleiQ9D0V8 MM

Interactioni

Subunit structurei

Homodimer. Interacts with CDK2 and CDC7. Interacts with the components of the replication complex, MCM2, MCM3, MCM4, MCM5, MCM6, MCM7 and with ORC2-containing complexes (By similarity). Interacts with ATRIP (By similarity). Interacts with CEP152 (By similarity).By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000035245

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili73 – 107Sequence analysisAdd BLAST35

Sequence similaritiesi

Belongs to the CINP family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IWVU Eukaryota
ENOG4111M0E LUCA
GeneTreeiENSGT00390000015784
HOGENOMiHOG000035137
HOVERGENiHBG061504
InParanoidiQ9D0V8
OMAiRPPLFHT
OrthoDBiEOG091G0RIF
PhylomeDBiQ9D0V8
TreeFamiTF329462

Family and domain databases

InterProiView protein in InterPro
IPR023250 Cyclin-dep_Kinase_2_interact
PRINTSiPR02040 CDK2IP

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 7 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: Q9D0V8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEAKTLGIAT PRKPVLSVSA RKLKDNAADW HNLILKWDSL SDKGFTTASS
60 70 80 90 100
IANLKVSLLS KEKVELESSS PASMEEEEKT NLDYDKGLEA LCEELQAILD
110 120 130 140 150
GLTKIQMKME KLSSTTKGIC ELENYHYREE SSRPPLFHTW PTAFFYEVSR
160 170 180 190 200
RLSEAYKKEL LLKHTIGAEL AHTADRNLSL TYLSMWLHQP YIESNSKLQL
210
ESMLLETGHR AL
Length:212
Mass (Da):24,104
Last modified:June 1, 2001 - v1
Checksum:iC9977FD22DBE8AF9
GO
Isoform 2 (identifier: Q9D0V8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     103-117: TKIQMKMEKLSSTTK → GIQHPVLVCTAPTHK
     118-212: Missing.

Note: No experimental confirmation available.
Show »
Length:117
Mass (Da):12,760
Checksum:iBC4D73EAF18A48A0
GO
Isoform 3 (identifier: Q9D0V8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     102-137: LTKIQMKMEKLSSTTKGICELENYHYREESSRPPLF → MVRPKDAGHRHHCLGLLTVGAFRTVGGLSFHLPNKS
     138-212: Missing.

Note: No experimental confirmation available.
Show »
Length:137
Mass (Da):14,956
Checksum:iD642244E60C88571
GO

Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1Y7VN75A0A1Y7VN75_MOUSE
Cyclin-dependent kinase 2-interacti...
Cinp
262Annotation score:
A0A1Y7VLF5A0A1Y7VLF5_MOUSE
Cyclin-dependent kinase 2-interacti...
Cinp
118Annotation score:
A0A1Y7VJ98A0A1Y7VJ98_MOUSE
Cyclin-dependent kinase 2-interacti...
Cinp
145Annotation score:
A0A1Y7VJ59A0A1Y7VJ59_MOUSE
Cyclin-dependent kinase 2-interacti...
Cinp
71Annotation score:
A0A1Y7VMK7A0A1Y7VMK7_MOUSE
Cyclin-dependent kinase 2-interacti...
Cinp
116Annotation score:
A0A1Y7VMU4A0A1Y7VMU4_MOUSE
Cyclin-dependent kinase 2-interacti...
Cinp
139Annotation score:
A0A1Y7VNN8A0A1Y7VNN8_MOUSE
Cyclin-dependent kinase 2-interacti...
Cinp
84Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_032527102 – 137LTKIQ…RPPLF → MVRPKDAGHRHHCLGLLTVG AFRTVGGLSFHLPNKS in isoform 3. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_032525103 – 117TKIQM…SSTTK → GIQHPVLVCTAPTHK in isoform 2. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_032526118 – 212Missing in isoform 2. 1 PublicationAdd BLAST95
Alternative sequenceiVSP_032528138 – 212Missing in isoform 3. 1 PublicationAdd BLAST75

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK004355 mRNA Translation: BAB23273.1
AK007812 mRNA Translation: BAB25277.1
AK076126 mRNA Translation: BAC36203.1
AK032155 mRNA Translation: BAC27729.1
BC011066 mRNA Translation: AAH11066.1
CCDSiCCDS36561.1 [Q9D0V8-1]
RefSeqiNP_080324.1, NM_026048.4 [Q9D0V8-1]
UniGeneiMm.287157

Genome annotation databases

EnsembliENSMUST00000043716; ENSMUSP00000035245; ENSMUSG00000021276 [Q9D0V8-1]
GeneIDi67236
KEGGimmu:67236
UCSCiuc007pcb.2 mouse [Q9D0V8-1]
uc007pcd.2 mouse [Q9D0V8-2]
uc007pce.2 mouse [Q9D0V8-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCINP_MOUSE
AccessioniPrimary (citable) accession number: Q9D0V8
Secondary accession number(s): Q8C063, Q9D8P9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: June 1, 2001
Last modified: September 12, 2018
This is version 100 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again