Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - Q9D074 (MGRN1_MOUSE)

Entry version 164 (23 Feb 2022)
Sequence version 2 (01 Mar 2003)
Previous versions | rss
Add a publicationFeedback
Protein

E3 ubiquitin-protein ligase MGRN1

Gene

Mgrn1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

E3 ubiquitin-protein ligase. Mediates TSG101 monoubiquitination at multiple sites. Plays a role in the regulation of endosome-to-lysosome trafficking. Impairs MC1R- and MC4R-signaling by competing with GNAS-binding to MCRs and inhibiting agonist-induced cAMP production. Does not inhibit ADRB2-signaling. Does not promote MC1R ubiquitination (By similarity).

Acts also as a negative regulator of hedgehog signaling (PubMed:29290584).

By similarity3 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. EC:2.3.2.27

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri277 – 316RING-typePROSITE-ProRule annotationAdd BLAST40

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processUbl conjugation pathway
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-983168, Antigen processing: Ubiquitination & Proteasome degradation

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...UniPathwayi		UPA00143

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
E3 ubiquitin-protein ligase MGRN1 (EC:2.3.2.27)
Alternative name(s):
Mahogunin RING finger protein 1
RING-type E3 ubiquitin transferase MGRN1Curated
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Mgrn1
Synonyms:Kiaa0544
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:2447670, Mgrn1

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSMUSG00000022517

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Endosome, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mutant mice have a pleiotropic phenotype that includes the absence of yellow hair pigment, curly hair and whiskers, abnormal craniofacial patterning, reduced embryonic viability due to mispatterning of the left-right body axis and age-dependent spongiform neurodegeneration. Many months before onset of vacuolation, mitochondrial complex IV expression and activity is significantly reduced in mutant brains and oxidative stress is increased. A global reduction of ubiquitinated proteins in the brain is observed. At 1 month of age, null mutant mouse brains have less ubiquitinated TSG101, while adult mutant brains contain more ubiquitinated and insoluble TSG101 than wild type. At 1 month of age, significant increase in EGFR levels in the brains of null mutant mice relative to wild-type mice, suggesting an impaired trafficking to the lysosome for degradation.5 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi278 – 281CVVC → AVVA: Loss of ubiquitin-protein ligase activity. Increase in TSG101-binding. 1 Publication4
Mutagenesisi384 – 387PSAP → ASAA: Loss of TSG101-binding. 1 Publication4

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002466882 – 532E3 ubiquitin-protein ligase MGRN1Add BLAST531

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi2N-myristoyl glycineBy similarity1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei389PhosphotyrosineCombined sources1
Modified residuei428PhosphoserineCombined sources1
Modified residuei449PhosphoserineCombined sources1
Modified residuei452PhosphoserineCombined sources1
Modified residuei501PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Autoubiquitinated in vitro.1 Publication

Keywords - PTMi

Lipoprotein, Myristate, Phosphoprotein, Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9D074

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9D074

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9D074

PeptideAtlas

More...PeptideAtlasi		Q9D074

PRoteomics IDEntifications database

More...PRIDEi		Q9D074

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		293471 [Q9D074-1]
293472 [Q9D074-2]
293473 [Q9D074-3]
293474 [Q9D074-4]
293475 [Q9D074-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9D074

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9D074

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed, with highest levels in brain, heart, kidney and liver. In the CNS, especially prominent in the Purkinje cells of the cerebellum. In the skin, expressed in the basal layer of the epidermis and hair follicles, primarily in the outer root sheath. Isoforms 1, 3, 4 and 5 are equally expressed in the liver. Isoforms 1, 3 and 4 are most abundant in brain, kidney and heart, respectively.4 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

In presomite and early somite stage embryos, most strongly expressed in the node and more weakly in the neuroepithelium. In 6- to 12-somite embryos, strongest expression in the node, symmetrically in the floor plate of the neural tube and in the developing heart; weaker expression in paraxial mesoderm, somites, neuroepithelium, as well as in hind- and foregut pockets. By 9.5 dpc, virtually ubiquitous.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000022517, Expressed in cerebellum and 277 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9D074, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MC1R and MC4R (By similarity).

Interacts with TSG101.

Interacts with mislocalized cytosolically exposed PRNP; this interaction alters MGRN1 subcellular location and causes lysosomal enlargement.

By similarity2 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		201365, 4 interactors

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000023159

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9D074, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni419 – 518DisorderedSequence analysisAdd BLAST100

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi384 – 387Required for TSG101-binding4

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi419 – 435Polar residuesSequence analysisAdd BLAST17

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The RING finger is required for ubiquitin ligase activity.

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri277 – 316RING-typePROSITE-ProRule annotationAdd BLAST40

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG4265, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000009925

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_016631_1_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9D074

Identification of Orthologs from Complete Genome Data

More...OMAi		CAQSGPP

Database of Orthologous Groups

More...OrthoDBi		883624at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9D074

TreeFam database of animal gene trees

More...TreeFami		TF314969

Family and domain databases

Conserved Domains Database

More...CDDi		cd16789, mRING-HC-C3HC5_MGRN1_like---blasttree, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.30.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR045194, MGRN1/RNF157-like
IPR045195, MGRN1/RNF157_mRING_C3HC5
IPR001841, Znf_RING
IPR013083, Znf_RING/FYVE/PHD

The PANTHER Classification System

More...PANTHERi		PTHR22996, PTHR22996, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00184, RING, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50089, ZF_RING_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9D074-1) [UniParc]FASTAAdd to basket
Also known as: I

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGSILSRRIA GVEDIDIQAN SAYRYPPKSG NYFASHFFMG GEKFDTPHPE 
        60         70         80         90        100
GYLFGENMDL NFLGSRPVQF PYVTPAPHEP VKTLRSLVNI RKDSLRLVRY 
       110        120        130        140        150
KEDADSPTED GEKPRVLYSL EFTFDADARV AITIYCQAVE ELVNGVAVYS 
       160        170        180        190        200
CKNPSLQSET VHYKRGVSQQ FSLPSFKIDF SEWKDDELNF DLDRGVFPVV 
       210        220        230        240        250
IQAVVDEGDV VEVTGHAHVL LAAFEKHVDG SFSVKPLKQK QIVDRVSYLL 
       260        270        280        290        300
QEIYGIENKN NQETKPSDDE NSDNSSECVV CLSDLRDTLI LPCRHLCLCT 
       310        320        330        340        350
SCADTLRYQA NNCPICRLPF RALLQIRAVR KKPGALSPIS FSPVLAQSVD 
       360        370        380        390        400
HDEHSSSDSI PPGYEPISLL EALNGLRAVS PAIPSAPLYE EITYSGISDG 
       410        420        430        440        450
LSQASCPLAG LDRIMESGLQ KGKTQSKSPD STLRSPSFPI HEEDEEKLSE 
       460        470        480        490        500
DSDAPLPPSG VELVLRESSS PESFGTEEGD EPSLKQGSRV PSIDDVLQDG 
       510        520        530 
SPQHHGCSQP VPPADIYLPA LGPESCSVGI EE
Note: Sufficient for normal development, pigmentation and neuronal integrity.
Length:532
Mass (Da):58,477
Last modified:March 1, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i89C2C1A28F9417EE
GO
Isoform 2 (identifier: Q9D074-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     29-29: S → SA

Show »
Length:533
Mass (Da):58,549
Checksum:i1ACFD952FAC71238
GO
Isoform 3 (identifier: Q9D074-3) [UniParc]FASTAAdd to basket
Also known as: III

The sequence of this isoform differs from the canonical sequence as follows:
     520-532: ALGPESCSVGIEE → GWSTSMETPHSLGTTSSPWPLLSGSSPEPGVAELTPF

Note: Sufficient for normal development, pigmentation and neuronal integrity.Curated
Show »
Length:556
Mass (Da):61,016
Checksum:iE90C158E4A7D50C6
GO
Isoform 4 (identifier: Q9D074-4) [UniParc]FASTAAdd to basket
Also known as: II

The sequence of this isoform differs from the canonical sequence as follows:
     355-355: S → SCPFKKSKSHPASLASKKPKRET

Note: Partial rescue of the phenotype of mutant null mice.Curated
Show »
Length:554
Mass (Da):60,915
Checksum:iC6F0746632E6EBAF
GO
Isoform 5 (identifier: Q9D074-5) [UniParc]FASTAAdd to basket
Also known as: IV

The sequence of this isoform differs from the canonical sequence as follows:
     355-355: S → SCPFKKSKSHPASLASKKPKRET
     520-532: ALGPESCSVGIEE → GWSTSMETPHSLGTTSSPWPLLSGSSPEPGVAELTPF

Note: Unable to rescue the phenotype of mutant null mice. This sequence has been deduced from the description in PubMed:19422019.Curated
Show »
Length:578
Mass (Da):63,454
Checksum:iFC7F672530E2675A
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti15I → F in BAE29360 (PubMed:16141072).Curated1
Sequence conflicti31N → D in BAE29360 (PubMed:16141072).Curated1
Sequence conflicti36H → R in BAE29360 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01985429S → SA in isoform 2. 1 Publication1
Alternative sequenceiVSP_019855355S → SCPFKKSKSHPASLASKKPK RET in isoform 4 and isoform 5. 1 Publication1
Alternative sequenceiVSP_019856520 – 532ALGPE…VGIEE → GWSTSMETPHSLGTTSSPWP LLSGSSPEPGVAELTPF in isoform 3 and isoform 5. 1 PublicationAdd BLAST13

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK011747 mRNA Translation: BAB27816.2
AK034100 mRNA Translation: BAC28587.1
AK088533 mRNA Translation: BAC40408.1
AK150176 mRNA Translation: BAE29360.1
AK153407 mRNA Translation: BAE31967.1
BC046830 mRNA Translation: AAH46830.1
AK129161 mRNA Translation: BAC97971.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS49751.1 [Q9D074-1]
CCDS57016.1 [Q9D074-2]
CCDS88868.1 [Q9D074-4]
CCDS88869.1 [Q9D074-3]

NCBI Reference Sequences

More...RefSeqi		NP_001239366.1, NM_001252437.1 [Q9D074-2]
NP_083933.1, NM_029657.4 [Q9D074-1]
XP_006521895.1, XM_006521832.1
XP_006521897.1, XM_006521834.1
XP_017172376.1, XM_017316887.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000023159; ENSMUSP00000023159; ENSMUSG00000022517 [Q9D074-3]
ENSMUST00000070658; ENSMUSP00000068314; ENSMUSG00000022517 [Q9D074-1]
ENSMUST00000229038; ENSMUSP00000155034; ENSMUSG00000022517 [Q9D074-2]
ENSMUST00000230990; ENSMUSP00000155425; ENSMUSG00000022517 [Q9D074-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		17237

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:17237

UCSC genome browser

More...UCSCi		uc007yap.2, mouse [Q9D074-1]
uc007yaq.2, mouse [Q9D074-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK011747 mRNA Translation: BAB27816.2
AK034100 mRNA Translation: BAC28587.1
AK088533 mRNA Translation: BAC40408.1
AK150176 mRNA Translation: BAE29360.1
AK153407 mRNA Translation: BAE31967.1
BC046830 mRNA Translation: AAH46830.1
AK129161 mRNA Translation: BAC97971.1
CCDSiCCDS49751.1 [Q9D074-1]
CCDS57016.1 [Q9D074-2]
CCDS88868.1 [Q9D074-4]
CCDS88869.1 [Q9D074-3]
RefSeqiNP_001239366.1, NM_001252437.1 [Q9D074-2]
NP_083933.1, NM_029657.4 [Q9D074-1]
XP_006521895.1, XM_006521832.1
XP_006521897.1, XM_006521834.1
XP_017172376.1, XM_017316887.1

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi201365, 4 interactors
STRINGi10090.ENSMUSP00000023159

PTM databases

iPTMnetiQ9D074
PhosphoSitePlusiQ9D074

Proteomic databases

jPOSTiQ9D074
MaxQBiQ9D074
PaxDbiQ9D074
PeptideAtlasiQ9D074
PRIDEiQ9D074
ProteomicsDBi293471 [Q9D074-1]
293472 [Q9D074-2]
293473 [Q9D074-3]
293474 [Q9D074-4]
293475 [Q9D074-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		2013, 243 antibodies from 28 providers

The DNASU plasmid repository

More...DNASUi		17237

Genome annotation databases

EnsembliENSMUST00000023159; ENSMUSP00000023159; ENSMUSG00000022517 [Q9D074-3]
ENSMUST00000070658; ENSMUSP00000068314; ENSMUSG00000022517 [Q9D074-1]
ENSMUST00000229038; ENSMUSP00000155034; ENSMUSG00000022517 [Q9D074-2]
ENSMUST00000230990; ENSMUSP00000155425; ENSMUSG00000022517 [Q9D074-4]
GeneIDi17237
KEGGimmu:17237
UCSCiuc007yap.2, mouse [Q9D074-1]
uc007yaq.2, mouse [Q9D074-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		23295
MGIiMGI:2447670, Mgrn1
VEuPathDBiHostDB:ENSMUSG00000022517

Rodent Unidentified Gene-Encoded large proteins database

More...Rougei		Search...

Phylogenomic databases

eggNOGiKOG4265, Eukaryota
GeneTreeiENSGT00390000009925
HOGENOMiCLU_016631_1_1_1
InParanoidiQ9D074
OMAiCAQSGPP
OrthoDBi883624at2759
PhylomeDBiQ9D074
TreeFamiTF314969

Enzyme and pathway databases

UniPathwayiUPA00143
ReactomeiR-MMU-983168, Antigen processing: Ubiquitination & Proteasome degradation

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		17237, 3 hits in 64 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Mgrn1, mouse

Protein Ontology

More...PROi		PR:Q9D074
RNActiQ9D074, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000022517, Expressed in cerebellum and 277 other tissues
GenevisibleiQ9D074, MM

Family and domain databases

CDDicd16789, mRING-HC-C3HC5_MGRN1_like---blasttree, 1 hit
Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR045194, MGRN1/RNF157-like
IPR045195, MGRN1/RNF157_mRING_C3HC5
IPR001841, Znf_RING
IPR013083, Znf_RING/FYVE/PHD
PANTHERiPTHR22996, PTHR22996, 1 hit
SMARTiView protein in SMART
SM00184, RING, 1 hit
PROSITEiView protein in PROSITE
PS50089, ZF_RING_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMGRN1_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9D074
Secondary accession number(s): Q3U5V9
, Q3UDA1, Q6ZQ97, Q8BZM9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: March 1, 2003
Last modified: February 23, 2022
This is version 164 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again