Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytosolic 5'-nucleotidase 3A

Gene

Nt5c3a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Nucleotidase which shows specific activity towards cytidine monophosphate (CMP) and 7-methylguanosine monophosphate (m7GMP). CMP seems to be the preferred substrate.By similarity

Catalytic activityi

N7-methyl-GMP + H2O = N7-methyl-guanosine + phosphate.By similarity
A 5'-ribonucleotide + H2O = a ribonucleoside + phosphate.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei83Nucleophile1 Publication1
Metal bindingi83Magnesium1 Publication1
Active sitei85Proton donor1 Publication1
Metal bindingi85Magnesium; via carbonyl oxygen1 Publication1
Binding sitei130CMPBy similarity1
Binding sitei130N(7)-methyl-GMPBy similarity1
Binding sitei151N(7)-methyl-GMPBy similarity1
Binding sitei247Substrate1 Publication1
Metal bindingi272Magnesium1 Publication1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionHydrolase, Transferase
Biological processNucleotide metabolism
LigandMagnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-MMU-73621 Pyrimidine catabolism

Names & Taxonomyi

Protein namesi
Recommended name:
Cytosolic 5'-nucleotidase 3A1 Publication (EC:3.1.3.51 Publication)
Alternative name(s):
7-methylguanosine phosphate-specific 5'-nucleotidaseBy similarity (EC:3.1.3.91By similarity)
Short name:
7-methylguanosine nucleotidase
Cytosolic 5'-nucleotidase 3
Cytosolic 5'-nucleotidase III
Short name:
cN-III
Lupin
Pyrimidine 5'-nucleotidase 1
Short name:
P5'N-1
Short name:
P5N-1
Short name:
PN-I
Gene namesi
Name:Nt5c3a
Synonyms:Nt5c3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:1927186 Nt5c3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000643881 – 331Cytosolic 5'-nucleotidase 3AAdd BLAST331

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei273PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9D020
PaxDbiQ9D020
PeptideAtlasiQ9D020
PRIDEiQ9D020

PTM databases

iPTMnetiQ9D020
PhosphoSitePlusiQ9D020

Expressioni

Tissue specificityi

Isoform 2 is highly expressed in the brain, heart, spleen, kidney and blood. Isoform 2 is expressed (at protein level) in the spleen, skeletal muscle and gastrointestinal epithelia.

Developmental stagei

Isoform 2 is weakly expressed from E7.5 and the expression level steadily increases through gestation. At E9.5 and E10.5 is first detected colocalizing with embryonic blood cells within the region of the septum transversum and within the cardiac chambers and dorsal aorta. At E12.5 expression is found in the ventral neural tube and in the trigeminal ganglia and in the liver and dorsal root ganglia. Expression persists in the liver, dorsal root and trigeminal ganglia at E13.5 and weaker expression becomes apparent in cardiac and skeletal muscle. At E16.5 expression is detected in liver, myocardium, tongue, bronchial epithelium, gastrointestinal epithelium, cartilage and forebrain neuroepithelium.

Gene expression databases

BgeeiENSMUSG00000029780
CleanExiMM_NT5C3
ExpressionAtlasiQ9D020 baseline and differential
GenevisibleiQ9D020 MM

Interactioni

Subunit structurei

Monomer.

Protein-protein interaction databases

IntActiQ9D020, 1 interactor
MINTiQ9D020
STRINGi10090.ENSMUSP00000031793

Structurei

Secondary structure

1331
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi44 – 46Combined sources3
Helixi48 – 50Combined sources3
Beta strandi55 – 58Combined sources4
Helixi60 – 77Combined sources18
Beta strandi78 – 82Combined sources5
Turni85 – 87Combined sources3
Beta strandi91 – 93Combined sources3
Helixi101 – 106Combined sources6
Helixi113 – 131Combined sources19
Beta strandi133 – 135Combined sources3
Helixi137 – 157Combined sources21
Helixi162 – 164Combined sources3
Helixi165 – 170Combined sources6
Helixi180 – 189Combined sources10
Beta strandi194 – 201Combined sources8
Helixi202 – 211Combined sources10
Beta strandi219 – 224Combined sources6
Beta strandi226 – 228Combined sources3
Beta strandi232 – 237Combined sources6
Helixi247 – 252Combined sources6
Helixi255 – 260Combined sources6
Turni261 – 263Combined sources3
Beta strandi266 – 273Combined sources8
Helixi274 – 278Combined sources5
Turni279 – 282Combined sources4
Beta strandi287 – 295Combined sources9
Helixi299 – 309Combined sources11
Beta strandi310 – 316Combined sources7
Helixi321 – 330Combined sources10

3D structure databases

ProteinModelPortaliQ9D020
SMRiQ9D020
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9D020

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni198 – 200Substrate binding1 Publication3

Sequence similaritiesi

Belongs to the pyrimidine 5'-nucleotidase family.Curated

Phylogenomic databases

eggNOGiKOG3128 Eukaryota
ENOG410ZQJ8 LUCA
GeneTreeiENSGT00390000012959
HOGENOMiHOG000244931
HOVERGENiHBG059750
InParanoidiQ9D020
KOiK01081
OMAiHNVIDNC
OrthoDBiEOG091G0BCN
PhylomeDBiQ9D020
TreeFamiTF314663

Family and domain databases

CDDicd07504 HAD_5NT, 1 hit
Gene3Di3.40.50.1000, 2 hits
InterProiView protein in InterPro
IPR036412 HAD-like_sf
IPR023214 HAD_sf
IPR006434 Pyrimidine_nucleotidase_eu
PfamiView protein in Pfam
PF05822 UMPH-1, 1 hit
SFLDiSFLDG01128 C1.4:_5'-Nucleotidase_Like, 1 hit
SUPFAMiSSF56784 SSF56784, 1 hit
TIGRFAMsiTIGR01544 HAD-SF-IE, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 2 (identifier: Q9D020-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDRAAVARVG AVASASVCAV VAGVVLAQYI FTLKRKTGRK TKIIEMMPEF
60 70 80 90 100
QKSSVRIKNP TRVEEIICGL IKGGAAKLQI ITDFDMTLSR FSYNGKRCPT
110 120 130 140 150
CHNIIDNCKL VTDECRRKLL QLKEQYYAIE VDPVLTVEEK FPYMVEWYTK
160 170 180 190 200
SHGLLIEQGI PKAKLKEIVA DSDVMLKEGY ENFFGKLQQH GIPVFIFSAG
210 220 230 240 250
IGDVLEEVIR QAGVYHSNVK VVSNFMDFDE NGVLKGFKGE LIHVFNKHDG
260 270 280 290 300
ALKNTDYFSQ LKDNSNIILL GDSQGDLRMA DGVANVEHIL KIGYLNDRVD
310 320 330
ELLEKYMDSY DIVLVKEESL EVVNSILQKT L
Length:331
Mass (Da):37,252
Last modified:November 14, 2006 - v4
Checksum:i9BE4CA16863E1E0F
GO
Isoform 1 (identifier: Q9D020-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MDRAAVARVGAVASASVCAVVAGVVLAQYIFTLKRKTGRKTKIIE → MTNQESAVHLK

Show »
Length:297
Mass (Da):33,790
Checksum:i906B9D08934EEB2E
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti183F → L in BAB27677 (PubMed:16141072).Curated1
Sequence conflicti260Q → R in BAB27901 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0215661 – 45MDRAA…TKIIE → MTNQESAVHLK in isoform 1. 1 PublicationAdd BLAST45

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK011525 mRNA Translation: BAB27677.2
AK011894 mRNA Translation: BAB27901.2
BC038029 mRNA Translation: AAH38029.1
CCDSiCCDS20171.1 [Q9D020-3]
CCDS57424.1 [Q9D020-1]
RefSeqiNP_001239303.1, NM_001252374.1 [Q9D020-1]
NP_080280.3, NM_026004.3 [Q9D020-3]
XP_006505335.1, XM_006505272.1
XP_006505336.1, XM_006505273.1 [Q9D020-1]
XP_011239413.1, XM_011241111.1 [Q9D020-1]
UniGeneiMm.158936
Mm.487949

Genome annotation databases

EnsembliENSMUST00000031793; ENSMUSP00000031793; ENSMUSG00000029780 [Q9D020-3]
ENSMUST00000101367; ENSMUSP00000098918; ENSMUSG00000029780 [Q9D020-1]
GeneIDi107569
KEGGimmu:107569
UCSCiuc009cbq.3 mouse [Q9D020-1]
uc009cbr.3 mouse [Q9D020-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry namei5NT3A_MOUSE
AccessioniPrimary (citable) accession number: Q9D020
Secondary accession number(s): Q8CI05, Q9D0D9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 13, 2005
Last sequence update: November 14, 2006
Last modified: June 20, 2018
This is version 139 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health