Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Chondrolectin

Gene

Chodl

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May play a role in the development of the nervous system such as in neurite outgrowth and elongation (PubMed:24067532). May be involved in motor axon growth and guidance (By similarity).By similarity1 Publication

Miscellaneous

Isoform 1 but not isoform 2 expression is down-regulated at postnatal day (P) 7 in spinal muscular atrophy (SMA) model motor neurons before onset of disease.1 Publication

GO - Molecular functioni

GO - Biological processi

  • regulation of neuron projection development Source: MGI

Keywordsi

Biological processNeurogenesis
LigandLectin

Names & Taxonomyi

Protein namesi
Recommended name:
Chondrolectin
Alternative name(s):
Transmembrane protein MT75
Gene namesi
Name:Chodl
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 16

Organism-specific databases

MGIiMGI:2179069 Chodl

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini22 – 216ExtracellularSequence analysisAdd BLAST195
Transmembranei217 – 237HelicalSequence analysisAdd BLAST21
Topological domaini238 – 273CytoplasmicSequence analysisAdd BLAST36

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 21Sequence analysisAdd BLAST21
ChainiPRO_000001741622 – 273ChondrolectinAdd BLAST252

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi61 ↔ 178PROSITE-ProRule annotation
Glycosylationi86N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi144 ↔ 170PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9CXM0
PRIDEiQ9CXM0

PTM databases

PhosphoSitePlusiQ9CXM0

Expressioni

Tissue specificityi

In adult mice preferentially expressed in skeletal muscle, testis, brain, and lung. Expressed in striated muscle (at protein level). Expressed in spinal chord. Detected in spinal chord fast motor neurons (at protein level).3 Publications

Developmental stagei

During gestation (embryonic day (E) 7-15) its expression is up-regulated. In E15 embryo is expressed in muscle cells of heterogeneous origin, including those from tongue, trunk, and tail. In newborn mice localized to limb striated muscle cells. Expressed in myoblasts undergoing myogenic differentiation during proliferation and differentiation phases (PubMed:12711387). Expressed in spinal chord motor neurons at E10.5. Detected in the plexus region of the developing limb bud at E10.5 and E11.5 (PubMed:20437528).2 Publications

Gene expression databases

BgeeiENSMUSG00000022860 Expressed in 216 organ(s), highest expression level in facial nucleus
CleanExiMM_CHODL
ExpressionAtlasiQ9CXM0 baseline and differential
GenevisibleiQ9CXM0 MM

Interactioni

Subunit structurei

Interacts with RABGGTB (PubMed:18161010).

Binary interactionsi

WithEntry#Exp.IntActNotes
RabggtbP536122EBI-13948582,EBI-9104297

Protein-protein interaction databases

IntActiQ9CXM0, 7 interactors
STRINGi10090.ENSMUSP00000023568

Structurei

3D structure databases

ProteinModelPortaliQ9CXM0
SMRiQ9CXM0
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini35 – 179C-type lectinPROSITE-ProRule annotationAdd BLAST145

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4297 Eukaryota
ENOG410XPJ1 LUCA
GeneTreeiENSGT00390000001844
HOGENOMiHOG000294068
HOVERGENiHBG050945
InParanoidiQ9CXM0
KOiK10078
OMAiSACPDLY
OrthoDBiEOG091G0FDX
TreeFamiTF330715

Family and domain databases

Gene3Di3.10.100.10, 1 hit
InterProiView protein in InterPro
IPR001304 C-type_lectin-like
IPR016186 C-type_lectin-like/link_sf
IPR016187 CTDL_fold
PfamiView protein in Pfam
PF00059 Lectin_C, 1 hit
SMARTiView protein in SMART
SM00034 CLECT, 1 hit
SUPFAMiSSF56436 SSF56436, 1 hit
PROSITEiView protein in PROSITE
PS50041 C_TYPE_LECTIN_2, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.1 Publication

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9CXM0-1) [UniParc]FASTAAdd to basket
Also known as: Chodl-001

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MIRIASLLLG AALLCAQGAF ARRVVSGQKV CFADVKHPCY KMAYFHELSS
60 70 80 90 100
RVSFQEARLA CESEGGVLLS LENEAEQKLI ESMLQNLTKP GTGISDGDFW
110 120 130 140 150
IGLLRSGDGQ TSGACPDLYQ WSDGSSSQFR NWYTDEPSCG SEKCVVMYHQ
160 170 180 190 200
PTANPGLGGP YLYQWNDDRC NMKHNYICKY EPEIHPTEPA EKPYLTNQPE
210 220 230 240 250
ETHENVVVTE AGIIPNLIYV IIPTIPLLLL ILVALGTCCF QMLHKSKGRS
260 270
KTSPNQSTLW ISKSTRKESG MEV
Length:273
Mass (Da):30,331
Last modified:October 3, 2012 - v3
Checksum:iF3EAE2B059D4EA28
GO
Isoform 2 (identifier: Q9CXM0-2) [UniParc]FASTAAdd to basket
Also known as: Chodl-002

The sequence of this isoform differs from the canonical sequence as follows:
     246-273: SKGRSKTSPNQSTLWISKSTRKESGMEV → RKARRHFIKDSTPLSSECLAESLNSNLVHMAGSLIPYHFQNNSPSLN

Show »
Length:292
Mass (Da):32,502
Checksum:i73E631C0714D54E2
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F2Z3Y6F2Z3Y6_MOUSE
Chondrolectin
Chodl
246Annotation score:
B7ZMQ3B7ZMQ3_MOUSE
Chodl protein
Chodl
268Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti24V → W in BAB29226 (PubMed:16141072).Curated1
Sequence conflicti179K → T in AAL50354 (PubMed:12711387).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_058918246 – 273SKGRS…SGMEV → RKARRHFIKDSTPLSSECLA ESLNSNLVHMAGSLIPYHFQ NNSPSLN in isoform 2. 2 PublicationsAdd BLAST28

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF311699 mRNA Translation: AAL50354.1
AK014255 mRNA Translation: BAB29226.1
AK076523 mRNA Translation: BAC36378.1
AK140910 mRNA Translation: BAE24517.1
AC114925 Genomic DNA No translation available.
AC161815 Genomic DNA No translation available.
BC117071 mRNA Translation: AAI17072.1
BC117073 mRNA Translation: AAI17074.1
CCDSiCCDS28279.1 [Q9CXM0-1]
RefSeqiNP_624360.2, NM_139134.3 [Q9CXM0-1]
XP_006523093.1, XM_006523030.3 [Q9CXM0-2]
UniGeneiMm.77895

Genome annotation databases

EnsembliENSMUST00000023568; ENSMUSP00000023568; ENSMUSG00000022860 [Q9CXM0-1]
ENSMUST00000069148; ENSMUSP00000063961; ENSMUSG00000022860 [Q9CXM0-2]
GeneIDi246048
KEGGimmu:246048
UCSCiuc007zsw.1 mouse [Q9CXM0-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Web resourcesi

Functional Glycomics Gateway - Glycan Binding

Chondrolectin

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF311699 mRNA Translation: AAL50354.1
AK014255 mRNA Translation: BAB29226.1
AK076523 mRNA Translation: BAC36378.1
AK140910 mRNA Translation: BAE24517.1
AC114925 Genomic DNA No translation available.
AC161815 Genomic DNA No translation available.
BC117071 mRNA Translation: AAI17072.1
BC117073 mRNA Translation: AAI17074.1
CCDSiCCDS28279.1 [Q9CXM0-1]
RefSeqiNP_624360.2, NM_139134.3 [Q9CXM0-1]
XP_006523093.1, XM_006523030.3 [Q9CXM0-2]
UniGeneiMm.77895

3D structure databases

ProteinModelPortaliQ9CXM0
SMRiQ9CXM0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ9CXM0, 7 interactors
STRINGi10090.ENSMUSP00000023568

PTM databases

PhosphoSitePlusiQ9CXM0

Proteomic databases

PaxDbiQ9CXM0
PRIDEiQ9CXM0

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000023568; ENSMUSP00000023568; ENSMUSG00000022860 [Q9CXM0-1]
ENSMUST00000069148; ENSMUSP00000063961; ENSMUSG00000022860 [Q9CXM0-2]
GeneIDi246048
KEGGimmu:246048
UCSCiuc007zsw.1 mouse [Q9CXM0-1]

Organism-specific databases

CTDi140578
MGIiMGI:2179069 Chodl

Phylogenomic databases

eggNOGiKOG4297 Eukaryota
ENOG410XPJ1 LUCA
GeneTreeiENSGT00390000001844
HOGENOMiHOG000294068
HOVERGENiHBG050945
InParanoidiQ9CXM0
KOiK10078
OMAiSACPDLY
OrthoDBiEOG091G0FDX
TreeFamiTF330715

Miscellaneous databases

PROiPR:Q9CXM0
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000022860 Expressed in 216 organ(s), highest expression level in facial nucleus
CleanExiMM_CHODL
ExpressionAtlasiQ9CXM0 baseline and differential
GenevisibleiQ9CXM0 MM

Family and domain databases

Gene3Di3.10.100.10, 1 hit
InterProiView protein in InterPro
IPR001304 C-type_lectin-like
IPR016186 C-type_lectin-like/link_sf
IPR016187 CTDL_fold
PfamiView protein in Pfam
PF00059 Lectin_C, 1 hit
SMARTiView protein in SMART
SM00034 CLECT, 1 hit
SUPFAMiSSF56436 SSF56436, 1 hit
PROSITEiView protein in PROSITE
PS50041 C_TYPE_LECTIN_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCHODL_MOUSE
AccessioniPrimary (citable) accession number: Q9CXM0
Secondary accession number(s): Q3US20, Q8BVU2, Q8VI31
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: October 3, 2012
Last modified: September 12, 2018
This is version 112 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again