UniProtKB - Q9CR73 (PNRC2_MOUSE)

BLAST

>sp|Q9CR73|PNRC2_MOUSE Proline-rich nuclear receptor coactivator 2 OS=Mus musculus OX=10090 GN=Pnrc2 PE=2 SV=1
MGGGERYNIPDPQSRNASKNQEQQNRQKSKDQNSSQTKIAHKKKERGHGYNPAAAAWQAM
QNGGKTKSLSNNSNWNAGLSSPSLLFKSQASQNYAGAKFSEPPSPSVLPKPPSHWVHVSL
NPSDKETMTFQLKTLLKVQV

Align
Format
Add to basket Added to basket
History
Entry version 110 (07 Nov 2018)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Proline-rich nuclear receptor coactivator 2

Gene

Pnrc2

Organism

Mus musculus (Mouse)

Status

Reviewed-Annotation score: -Experimental evidence at transcript levelⁱ

Functionⁱ

Involved in nonsense-mediated mRNA decay (NMD) by acting as a bridge between the mRNA decapping complex and the NMD machinery (By similarity). May act by targeting the NMD machinery to the P-body and recruiting the decapping machinery to aberrant mRNAs (By similarity). Required for UPF1/RENT1 localization to the P-body (By similarity). Plays a role in glucocorticoid receptor-mediated mRNA degradation by interacting with the glucocorticoid receptor NR3C1 in a ligand-dependent manner when it is bound to the 5' UTR of target mRNAs and recruiting the RNA helicase UPF1 and the mRNA-decapping enzyme DCP1A, leading to RNA decay (By similarity). Also acts as a nuclear receptor coactivator. May play a role in controlling the energy balance between energy storage and energy expenditure (PubMed:17971453).By similarity1 Publication

GO - Biological processⁱ

nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Source: UniProtKB

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Activator
Biological process	Nonsense-mediated mRNA decay, Transcription, Transcription regulation

Enzyme and pathway databases

Reactomeⁱ	R-MMU-975957 Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)

Reactomeⁱ

R-MMU-975957 Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Proline-rich nuclear receptor coactivator 2
Gene namesⁱ	Name:Pnrc2
Organismⁱ	Mus musculus (Mouse)
Taxonomic identifierⁱ	10090 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
Proteomesⁱ	UP000000589 Componentⁱ: Chromosome 4

Organism-specific databases

MGIⁱ	MGI:106512 Pnrc2

Keywords - Cellular componentⁱ

Cytoplasm, Nucleus

Pathology & Biotechⁱ

Disruption phenotypeⁱ

Mice are lean, resistant to high fat diet-induced obesity but without the induction of insulin resistance and have a higher metabolic rate than wild-type mice.1 Publication

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000058486	1 – 140	Proline-rich nuclear receptor coactivator 2Add BLAST		140

Proteomic databases

PaxDbⁱ	Q9CR73
PRIDEⁱ	Q9CR73

PTM databases

iPTMnetⁱ	Q9CR73
PhosphoSitePlusⁱ	Q9CR73

Expressionⁱ

Tissue specificityⁱ

Strong expression is detected in lung, spleen, ovary, thymus, and colon.1 Publication

Gene expression databases

Bgeeⁱ	ENSMUSG00000028675 Expressed in 294 organ(s), highest expression level in pituitary gland
CleanExⁱ	MM_PNRC2
ExpressionAtlasⁱ	Q9CR73 baseline and differential
Genevisibleⁱ	Q9CR73 MM

Interactionⁱ

Subunit structureⁱ

Interacts with UPF1/RENT1; preferentially interacts with hyperphosphorylated form. Interacts with DCP1A. Interacts with many nuclear receptors including ESR1, ESRRA, ESRRG, NR3C1/GR, NR5A1, PGR, TR, RAR and RXR.By similarity

Protein-protein interaction databases

STRINGⁱ	10090.ENSMUSP00000030436

STRINGⁱ

10090.ENSMUSP00000030436

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	Q9CR73
SMRⁱ	Q9CR73
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Motif

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Motifⁱ	100 – 106	SH3-binding		7

Domainⁱ

The interaction between PNRC2 and nuclear receptors is dependent on the SH3 binding motif.By similarity

Sequence similaritiesⁱ

Belongs to the PNRC family. PNRC2 subfamily.Curated

Phylogenomic databases

eggNOGⁱ	ENOG410IY3T Eukaryota ENOG4112BTC LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00530000063881
HOGENOMⁱ	HOG000115593
HOVERGENⁱ	HBG053627
InParanoidⁱ	Q9CR73
KEGG Orthology (KO) More...KOⁱ	K18751
OMAⁱ	ERGHTYN
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0SY3
PhylomeDBⁱ	Q9CR73

Family and domain databases

InterProⁱ	View protein in InterPro IPR026780 PNRC1/2 IPR026781 PNRC2
PANTHERⁱ	PTHR15405 PTHR15405, 1 hit PTHR15405:SF6 PTHR15405:SF6, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

This entry has 1 described isoform and 2 potential isoforms that are computationally mapped.Show all Align All

Q9CR73-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MGGGERYNIP DPQSRNASKN QEQQNRQKSK DQNSSQTKIA HKKKERGHGY 
        60         70         80         90        100
NPAAAAWQAM QNGGKTKSLS NNSNWNAGLS SPSLLFKSQA SQNYAGAKFS 
       110        120        130        140
EPPSPSVLPK PPSHWVHVSL NPSDKETMTF QLKTLLKVQV

Length:140

Mass (Da):15,401

Last modified:June 1, 2001 - v1

Checksum:ⁱ17321057158B36B3

Computationally mapped potential isoform sequencesⁱ

There are 2 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

Z4YMU7	Z4YMU7_MOUSE	Proline-rich nuclear receptor coact... Proline-rich nuclear receptor coactivator 2	Pnrc2	37	Annotation score:
J3QJZ8	J3QJZ8_MOUSE	Proline-rich nuclear receptor coact... Proline-rich nuclear receptor coactivator 2	Pnrc2	56	Annotation score:

Sequence cautionⁱ

The sequence CAM15897 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	98	K → Q in BAB31186 (PubMed:16141072).Curated		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AK011192 mRNA Translation: BAB27457.1 AK012073 mRNA Translation: BAB28010.1 AK013163 mRNA Translation: BAB28686.1 AK018384 mRNA Translation: BAB31186.1 AK075816 mRNA Translation: BAC35983.1 AK077403 mRNA Translation: BAC36786.1 AL672076 Genomic DNA Translation: CAM15896.1 AL672076 Genomic DNA Translation: CAM15897.1 Sequence problems. CH466552 Genomic DNA Translation: EDL29966.1 BC006598 mRNA Translation: AAH06598.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS18792.1
NCBI Reference Sequences More...RefSeqⁱ	NP_080659.1, NM_026383.3 XP_006539101.1, XM_006539038.1 XP_006539102.1, XM_006539039.1
UniGeneⁱ	Mm.29159

Genome annotation databases

Ensemblⁱ	ENSMUST00000030436; ENSMUSP00000030436; ENSMUSG00000028675
GeneIDⁱ	52830
KEGGⁱ	mmu:52830
UCSC genome browser More...UCSCⁱ	uc008vhf.2 mouse

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q9CR73	Proline-rich nuclear receptor coactivator 2 (Fragment)		MOUSE		37	UniRef100_Q9CR73

Protein	Similar proteins		Species	Score	Length	Source
Q9CR73	Proline-rich nuclear receptor coactivator 2 (Fragment)		MOUSE		37	UniRef90_Q9CR73

Protein	Similar proteins		Species	Score	Length	Source
Q9CR73	Proline-rich nuclear receptor coactivator 2	)	HUMAN		139	UniRef50_Q9NPJ4
Proline-rich nuclear receptor coactivator 2		BOVIN		139
Proline-rich nuclear receptor coactivator 2 A		XENLA		135
Proline-rich nuclear receptor coactivator 2		XENTR		136
Proline-rich nuclear receptor coactivator 2		CHICK		141
+192

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AK011192 mRNA Translation: BAB27457.1 AK012073 mRNA Translation: BAB28010.1 AK013163 mRNA Translation: BAB28686.1 AK018384 mRNA Translation: BAB31186.1 AK075816 mRNA Translation: BAC35983.1 AK077403 mRNA Translation: BAC36786.1 AL672076 Genomic DNA Translation: CAM15896.1 AL672076 Genomic DNA Translation: CAM15897.1 Sequence problems. CH466552 Genomic DNA Translation: EDL29966.1 BC006598 mRNA Translation: AAH06598.1
CCDSⁱ	CCDS18792.1
RefSeqⁱ	NP_080659.1, NM_026383.3 XP_006539101.1, XM_006539038.1 XP_006539102.1, XM_006539039.1
UniGeneⁱ	Mm.29159

3D structure databases

ProteinModelPortalⁱ	Q9CR73
SMRⁱ	Q9CR73
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

STRINGⁱ	10090.ENSMUSP00000030436

STRINGⁱ

10090.ENSMUSP00000030436

PTM databases

iPTMnetⁱ	Q9CR73
PhosphoSitePlusⁱ	Q9CR73

Proteomic databases

PaxDbⁱ	Q9CR73
PRIDEⁱ	Q9CR73

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	52830
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENSMUST00000030436; ENSMUSP00000030436; ENSMUSG00000028675
GeneIDⁱ	52830
KEGGⁱ	mmu:52830
UCSCⁱ	uc008vhf.2 mouse

Organism-specific databases

CTDⁱ	55629
MGIⁱ	MGI:106512 Pnrc2

Phylogenomic databases

eggNOGⁱ	ENOG410IY3T Eukaryota ENOG4112BTC LUCA
GeneTreeⁱ	ENSGT00530000063881
HOGENOMⁱ	HOG000115593
HOVERGENⁱ	HBG053627
InParanoidⁱ	Q9CR73
KOⁱ	K18751
OMAⁱ	ERGHTYN
OrthoDBⁱ	EOG091G0SY3
PhylomeDBⁱ	Q9CR73

Enzyme and pathway databases

Reactomeⁱ	R-MMU-975957 Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)

Reactomeⁱ

R-MMU-975957 Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)

Miscellaneous databases

ChiTaRSⁱ	Pnrc2 mouse
Protein Ontology More...PROⁱ	PR:Q9CR73
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSMUSG00000028675 Expressed in 294 organ(s), highest expression level in pituitary gland
CleanExⁱ	MM_PNRC2
ExpressionAtlasⁱ	Q9CR73 baseline and differential
Genevisibleⁱ	Q9CR73 MM

Family and domain databases

InterProⁱ	View protein in InterPro IPR026780 PNRC1/2 IPR026781 PNRC2
PANTHERⁱ	PTHR15405 PTHR15405, 1 hit PTHR15405:SF6 PTHR15405:SF6, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	PNRC2_MOUSE
Accessionⁱ	Q9CR73Primary (citable) accession number: Q9CR73 Secondary accession number(s): B1AV48, B1AV49, Q9CXC6
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	March 29, 2005
	Last sequence update:	June 1, 2001
	Last modified:	November 7, 2018
	This is version 110 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
MGD cross-references
Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q9CR73 (PNRC2_MOUSE)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Proline-rich nuclear receptor coactivator 2

Pnrc2

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Nucleus

Other locations

Golgi apparatus

Nucleus

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Experimental Info

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Sequence cautionⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ