Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mitochondrial import inner membrane translocase subunit TIM14

Gene

Dnajc19

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity (By similarity).By similarity

GO - Biological processi

Keywordsi

Molecular functionChaperone
Biological processProtein transport, Translocation, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
Mitochondrial import inner membrane translocase subunit TIM14
Alternative name(s):
DnaJ homolog subfamily C member 19
Gene namesi
Name:Dnajc19
Synonyms:Tim14, Timm14
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 3

Organism-specific databases

MGIiMGI:1914963 Dnajc19

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini2 – 3Mitochondrial intermembraneSequence analysis2
Transmembranei4 – 24HelicalSequence analysisAdd BLAST21
Topological domaini25 – 116Mitochondrial matrixSequence analysisAdd BLAST92

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00000711012 – 116Mitochondrial import inner membrane translocase subunit TIM14Add BLAST115

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineBy similarity1
Modified residuei39PhosphoserineBy similarity1
Modified residuei70PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ9CQV7
PRIDEiQ9CQV7

PTM databases

iPTMnetiQ9CQV7
PhosphoSitePlusiQ9CQV7

Expressioni

Gene expression databases

BgeeiENSMUSG00000027679 Expressed in 201 organ(s), highest expression level in brown adipose tissue
CleanExiMM_DNAJC19
ExpressionAtlasiQ9CQV7 baseline and differential
GenevisibleiQ9CQV7 MM

Interactioni

Subunit structurei

Probable component of the PAM complex at least composed of a mitochondrial HSP70 protein, GRPEL1 or GRPEL2, TIMM44, TIMM16/PAM16 and TIMM14/DNAJC19.By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000011029

Structurei

3D structure databases

ProteinModelPortaliQ9CQV7
SMRiQ9CQV7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini62 – 116JPROSITE-ProRule annotationAdd BLAST55

Sequence similaritiesi

Belongs to the TIM14 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0723 Eukaryota
COG2214 LUCA
GeneTreeiENSGT00390000017303
HOGENOMiHOG000115841
HOVERGENiHBG057483
InParanoidiQ9CQV7
KOiK09539
OMAiFDAESMA
PhylomeDBiQ9CQV7

Family and domain databases

CDDicd06257 DnaJ, 1 hit
Gene3Di1.10.287.110, 1 hit
InterProiView protein in InterPro
IPR001623 DnaJ_domain
IPR036869 J_dom_sf
PfamiView protein in Pfam
PF00226 DnaJ, 1 hit
SMARTiView protein in SMART
SM00271 DnaJ, 1 hit
SUPFAMiSSF46565 SSF46565, 1 hit
PROSITEiView protein in PROSITE
PS50076 DNAJ_2, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9CQV7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASTVVAVGL TIAAAGFAGR YVLQAMKHVE PQVKQVFQSL PKSAFGGGYY
60 70 80 90 100
RGGFEPKMTK REAALILGVS PTANKGKIRD AHRRIMLLNH PDKGGSPYIA
110
AKINEAKDLL EGQAKK
Length:116
Mass (Da):12,437
Last modified:January 23, 2007 - v3
Checksum:i51E4313DB4F6083E
GO
Isoform 2 (identifier: Q9CQV7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     95-116: GSPYIAAKINEAKDLLEGQAKK → PLVEEGLKPI...TPVKPCETTM

Note: No experimental confirmation available.
Show »
Length:157
Mass (Da):16,956
Checksum:i7D8BC9DF54F2BDAA
GO
Isoform 3 (identifier: Q9CQV7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     95-116: GSPYIAAKINEAKDLLEGQAKK → KQLLLLYWTVNGIANSWCYECLCVSSFPVVDHIVVS

Note: No experimental confirmation available.
Show »
Length:130
Mass (Da):14,193
Checksum:iA7EE66196A6A7B2F
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3Z5K6D3Z5K6_MOUSE
Mitochondrial import inner membrane...
Dnajc19
110Annotation score:
G3X8S1G3X8S1_MOUSE
DnaJ (Hsp40) homolog, subfamily C, ...
Dnajc19 mCG_15246
157Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01639095 – 116GSPYI…GQAKK → PLVEEGLKPIPICRSCSSIC RRSILSCSTSYDQNKNPFTV CVCVHSSAHTGIHTPVKPCE TTM in isoform 2. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_01639195 – 116GSPYI…GQAKK → KQLLLLYWTVNGIANSWCYE CLCVSSFPVVDHIVVS in isoform 3. 1 PublicationAdd BLAST22

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK007866 mRNA Translation: BAB25317.1
AK008267 mRNA Translation: BAB25565.1
AK010204 mRNA Translation: BAB26767.1
AK012051 mRNA Translation: BAB27993.1
BC024335 mRNA Translation: AAH24335.1
CCDSiCCDS38411.1 [Q9CQV7-2]
CCDS38412.1 [Q9CQV7-1]
CCDS71233.1 [Q9CQV7-3]
RefSeqiNP_001021382.1, NM_001026211.2
NP_001273901.1, NM_001286972.1 [Q9CQV7-3]
NP_001273902.1, NM_001286973.1
NP_080608.3, NM_026332.4 [Q9CQV7-1]
XP_003084767.1, XM_003084719.3 [Q9CQV7-1]
UniGeneiMm.274266

Genome annotation databases

EnsembliENSMUST00000108195; ENSMUSP00000103830; ENSMUSG00000027679 [Q9CQV7-1]
ENSMUST00000117223; ENSMUSP00000113484; ENSMUSG00000027679 [Q9CQV7-3]
GeneIDi100503724
67713
KEGGimmu:100503724
mmu:67713
UCSCiuc008oxo.2 mouse [Q9CQV7-1]
uc008oxp.2 mouse [Q9CQV7-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK007866 mRNA Translation: BAB25317.1
AK008267 mRNA Translation: BAB25565.1
AK010204 mRNA Translation: BAB26767.1
AK012051 mRNA Translation: BAB27993.1
BC024335 mRNA Translation: AAH24335.1
CCDSiCCDS38411.1 [Q9CQV7-2]
CCDS38412.1 [Q9CQV7-1]
CCDS71233.1 [Q9CQV7-3]
RefSeqiNP_001021382.1, NM_001026211.2
NP_001273901.1, NM_001286972.1 [Q9CQV7-3]
NP_001273902.1, NM_001286973.1
NP_080608.3, NM_026332.4 [Q9CQV7-1]
XP_003084767.1, XM_003084719.3 [Q9CQV7-1]
UniGeneiMm.274266

3D structure databases

ProteinModelPortaliQ9CQV7
SMRiQ9CQV7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000011029

PTM databases

iPTMnetiQ9CQV7
PhosphoSitePlusiQ9CQV7

Proteomic databases

PaxDbiQ9CQV7
PRIDEiQ9CQV7

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000108195; ENSMUSP00000103830; ENSMUSG00000027679 [Q9CQV7-1]
ENSMUST00000117223; ENSMUSP00000113484; ENSMUSG00000027679 [Q9CQV7-3]
GeneIDi100503724
67713
KEGGimmu:100503724
mmu:67713
UCSCiuc008oxo.2 mouse [Q9CQV7-1]
uc008oxp.2 mouse [Q9CQV7-3]

Organism-specific databases

CTDi100503724
131118
MGIiMGI:1914963 Dnajc19

Phylogenomic databases

eggNOGiKOG0723 Eukaryota
COG2214 LUCA
GeneTreeiENSGT00390000017303
HOGENOMiHOG000115841
HOVERGENiHBG057483
InParanoidiQ9CQV7
KOiK09539
OMAiFDAESMA
PhylomeDBiQ9CQV7

Miscellaneous databases

ChiTaRSiDnajc19 mouse
PROiPR:Q9CQV7
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000027679 Expressed in 201 organ(s), highest expression level in brown adipose tissue
CleanExiMM_DNAJC19
ExpressionAtlasiQ9CQV7 baseline and differential
GenevisibleiQ9CQV7 MM

Family and domain databases

CDDicd06257 DnaJ, 1 hit
Gene3Di1.10.287.110, 1 hit
InterProiView protein in InterPro
IPR001623 DnaJ_domain
IPR036869 J_dom_sf
PfamiView protein in Pfam
PF00226 DnaJ, 1 hit
SMARTiView protein in SMART
SM00271 DnaJ, 1 hit
SUPFAMiSSF46565 SSF46565, 1 hit
PROSITEiView protein in PROSITE
PS50076 DNAJ_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiTIM14_MOUSE
AccessioniPrimary (citable) accession number: Q9CQV7
Secondary accession number(s): Q8R1N1, Q9D896
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 6, 2005
Last sequence update: January 23, 2007
Last modified: September 12, 2018
This is version 134 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again