UniProtKB - Q9CQS8 (SC61B_MOUSE)

BLAST

>sp|Q9CQS8|SC61B_MOUSE Protein transport protein Sec61 subunit beta OS=Mus musculus OX=10090 GN=Sec61b PE=1 SV=3
MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYT
EDSPGLKVGPVPVLVMSLLFIAAVFMLHIWGKYTRS

Align
Format
Add to basket Added to basket
History
Entry version 129 (07 Nov 2018)
Sequence version 3 (23 Jan 2007)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Protein transport protein Sec61 subunit beta

Gene

Sec61b

Organism

Mus musculus (Mouse)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Component of SEC61 channel-forming translocon complex that mediates transport of signal peptide-containing precursor polypeptides across endoplasmic reticulum (ER) (By similarity). Required for PKD1/Polycystin-1 biogenesis (PubMed:28375157).By similarity1 Publication

GO - Molecular functionⁱ

ARF guanyl-nucleotide exchange factor activity
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
epidermal growth factor binding Source: MGI
ribosome binding
Source: MGI
Inferred from direct assayⁱ
- 16705175

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

posttranslational protein targeting to membrane, translocation
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
protein import into nucleus, translocation Source: MGI
retrograde protein transport, ER to cytosol Source: MGI
SRP-dependent cotranslational protein targeting to membrane, translocation
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
ubiquitin-dependent ERAD pathway Source: MGI

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Biological process	Protein transport, Translocation, Transport

Biological process

Protein transport, Translocation, Transport

Enzyme and pathway databases

Reactomeⁱ	R-MMU-381038 XBP1(S) activates chaperone genes

Reactomeⁱ

R-MMU-381038 XBP1(S) activates chaperone genes

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Protein transport protein Sec61 subunit beta
Gene namesⁱ	Name:Sec61b1 PublicationImported
Organismⁱ	Mus musculus (Mouse)
Taxonomic identifierⁱ	10090 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
Proteomesⁱ	UP000000589 Componentⁱ: Chromosome 4

Organism-specific databases

MGIⁱ	MGI:1913462 Sec61b

Topology

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Topological domainⁱ	2 – 70	CytoplasmicSequence analysisAdd BLAST		69
Transmembraneⁱ	71 – 91	HelicalSequence analysisAdd BLAST		21

Keywords - Cellular componentⁱ

Endoplasmic reticulum, Membrane

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Initiator methionineⁱ		RemovedBy similarity
ChainⁱPRO_0000157255	2 – 96	Protein transport protein Sec61 subunit betaAdd BLAST		95

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Modified residueⁱ	2	N-acetylprolineBy similarity	1
Modified residueⁱ	7	PhosphoserineBy similarity	1
Modified residueⁱ	9	PhosphothreonineBy similarity	1
Modified residueⁱ	13	PhosphoserineBy similarity	1
Modified residueⁱ	14	PhosphoserineBy similarity	1
Modified residueⁱ	17	PhosphoserineBy similarity	1
Lipidationⁱ	39	S-palmitoyl cysteineBy similarity	1

Keywords - PTMⁱ

Acetylation, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

EPDⁱ	Q9CQS8
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	Q9CQS8
PaxDbⁱ	Q9CQS8
PeptideAtlas More...PeptideAtlasⁱ	Q9CQS8
PRIDEⁱ	Q9CQS8
TopDownProteomicsⁱ	Q9CQS8

PTM databases

iPTMnetⁱ	Q9CQS8
PhosphoSitePlusⁱ	Q9CQS8
SwissPalmⁱ	Q9CQS8

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSMUSG00000053317 Expressed in 70 organ(s), highest expression level in dorsal pancreas
CleanExⁱ	MM_SEC61B
ExpressionAtlasⁱ	Q9CQS8 baseline and differential
Genevisibleⁱ	Q9CQS8 MM

Interactionⁱ

Subunit structureⁱ

The ER translocon complex consists of channel-forming core components SEC61A1, SEC61B and SEC61G and different auxiliary components such as SEC62 and SEC63.By similarity

GO - Molecular functionⁱ

ARF guanyl-nucleotide exchange factor activity
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
epidermal growth factor binding Source: MGI

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	211302, 3 interactors
CORUMⁱ	Q9CQS8
IntActⁱ	Q9CQS8, 2 interactors
STRINGⁱ	10090.ENSMUSP00000067681

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	Q9CQS8
SMRⁱ	Q9CQS8
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the SEC61-beta family.Curated

Keywords - Domainⁱ

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGⁱ	KOG3457 Eukaryota ENOG4111UAR LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000003561
HOGENOMⁱ	HOG000211109
HOVERGENⁱ	HBG061281
InParanoidⁱ	Q9CQS8
KEGG Orthology (KO) More...KOⁱ	K09481
OMAⁱ	NSGGMWR
PhylomeDBⁱ	Q9CQS8
TreeFamⁱ	TF313144

Family and domain databases

InterProⁱ	View protein in InterPro IPR030671 Sec61-beta/Sbh IPR016482 SecG/Sec61-beta/Sbh
PANTHERⁱ	PTHR13509 PTHR13509, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF03911 Sec61_beta, 1 hit
PIRSFⁱ	PIRSF006398 Sec61_beta_euk, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry has 1 described isoform and 2 potential isoforms that are computationally mapped.Show all Align All

Q9CQS8-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MPGPTPSGTN VGSSGRSPSK AVAARAAGST VRQRKNASCG TRSAGRTTSA 
        60         70         80         90 
GTGGMWRFYT EDSPGLKVGP VPVLVMSLLF IAAVFMLHIW GKYTRS

Length:96

Mass (Da):9,958

Last modified:January 23, 2007 - v3

Checksum:ⁱ5FAFF4197A742049

Computationally mapped potential isoform sequencesⁱ

There are 2 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

A8Y5P9	A8Y5P9_MOUSE	Protein transport protein Sec61 sub... Protein transport protein Sec61 subunit beta	Sec61b	117	Annotation score:
A8Y5P8	A8Y5P8_MOUSE	Protein transport protein Sec61 sub... Protein transport protein Sec61 subunit beta	Sec61b	140	Annotation score:

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AK004505 mRNA Translation: BAB23338.1 AK008739 mRNA Translation: BAB25868.1 BC002089 mRNA Translation: AAH02089.1 BC081445 mRNA Translation: AAH81445.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS38759.1
NCBI Reference Sequences More...RefSeqⁱ	NP_077133.1, NM_024171.2
UniGeneⁱ	Mm.20188

Genome annotation databases

Ensemblⁱ	ENSMUST00000065678; ENSMUSP00000067681; ENSMUSG00000053317
GeneIDⁱ	66212
KEGGⁱ	mmu:66212
UCSC genome browser More...UCSCⁱ	uc008sur.1 mouse

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q9CQS8	Protein transport protein Sec61 subunit beta		CAVPO		96	UniRef100_Q9CQS8
UPI000C878601		CAVPO		182

Protein	Similar proteins		Species	Score	Length	Source
Q9CQS8	Protein transport protein Sec61 subunit beta		CAVPO		96	UniRef90_Q9CQS8
UPI000C878601		CAVPO		182

Protein	Similar proteins		Species	Score	Length	Source
Q9CQS8	Protein transport protein Sec61 subunit beta		CAVPO		96	UniRef50_Q9CQS8
Protein transport protein Sec61 subunit beta		MYODS		178
Protein transport protein Sec61 subunit beta (Fragment)		MYOBR		96
Protein transport protein Sec61 subunit beta (Fragment)		MACMU		96
Protein transport protein Sec61 subunit beta (Fragment)		TUPCH		96
+9

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AK004505 mRNA Translation: BAB23338.1 AK008739 mRNA Translation: BAB25868.1 BC002089 mRNA Translation: AAH02089.1 BC081445 mRNA Translation: AAH81445.1
CCDSⁱ	CCDS38759.1
RefSeqⁱ	NP_077133.1, NM_024171.2
UniGeneⁱ	Mm.20188

3D structure databases

ProteinModelPortalⁱ	Q9CQS8
SMRⁱ	Q9CQS8
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	211302, 3 interactors
CORUMⁱ	Q9CQS8
IntActⁱ	Q9CQS8, 2 interactors
STRINGⁱ	10090.ENSMUSP00000067681

PTM databases

iPTMnetⁱ	Q9CQS8
PhosphoSitePlusⁱ	Q9CQS8
SwissPalmⁱ	Q9CQS8

Proteomic databases

EPDⁱ	Q9CQS8
MaxQBⁱ	Q9CQS8
PaxDbⁱ	Q9CQS8
PeptideAtlasⁱ	Q9CQS8
PRIDEⁱ	Q9CQS8
TopDownProteomicsⁱ	Q9CQS8

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENSMUST00000065678; ENSMUSP00000067681; ENSMUSG00000053317
GeneIDⁱ	66212
KEGGⁱ	mmu:66212
UCSCⁱ	uc008sur.1 mouse

Organism-specific databases

CTDⁱ	10952
MGIⁱ	MGI:1913462 Sec61b

Phylogenomic databases

eggNOGⁱ	KOG3457 Eukaryota ENOG4111UAR LUCA
GeneTreeⁱ	ENSGT00390000003561
HOGENOMⁱ	HOG000211109
HOVERGENⁱ	HBG061281
InParanoidⁱ	Q9CQS8
KOⁱ	K09481
OMAⁱ	NSGGMWR
PhylomeDBⁱ	Q9CQS8
TreeFamⁱ	TF313144

Enzyme and pathway databases

Reactomeⁱ	R-MMU-381038 XBP1(S) activates chaperone genes

Reactomeⁱ

R-MMU-381038 XBP1(S) activates chaperone genes

Miscellaneous databases

ChiTaRSⁱ	Sec61b mouse
Protein Ontology More...PROⁱ	PR:Q9CQS8
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSMUSG00000053317 Expressed in 70 organ(s), highest expression level in dorsal pancreas
CleanExⁱ	MM_SEC61B
ExpressionAtlasⁱ	Q9CQS8 baseline and differential
Genevisibleⁱ	Q9CQS8 MM

Family and domain databases

InterProⁱ	View protein in InterPro IPR030671 Sec61-beta/Sbh IPR016482 SecG/Sec61-beta/Sbh
PANTHERⁱ	PTHR13509 PTHR13509, 1 hit
Pfamⁱ	View protein in Pfam PF03911 Sec61_beta, 1 hit
PIRSFⁱ	PIRSF006398 Sec61_beta_euk, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	SC61B_MOUSE
Accessionⁱ	Q9CQS8Primary (citable) accession number: Q9CQS8
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	February 16, 2004
	Last sequence update:	January 23, 2007
	Last modified:	November 7, 2018
	This is version 129 of the entry and version 3 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Direct protein sequencing, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
MGD cross-references
Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q9CQS8 (SC61B_MOUSE)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Protein transport protein Sec61 subunit beta

Sec61b

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Endoplasmic reticulum

Endoplasmic reticulum

Other locations

Topology

Keywords - Cellular componenti

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ