Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9CPX5 (PLAT5_MOUSE)

Entry version 117 (10 Feb 2021)
Sequence version 2 (31 Jan 2002)
Previous versions | rss
Add a publicationFeedback
Protein

Phospholipase A and acyltransferase 5

Gene

Plaat5

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Exhibits both phospholipase A1/2 and acyltransferase activities (By similarity). Shows phospholipase A1 (PLA1) and A2 (PLA2) activity, catalyzing the calcium-independent release of fatty acids from the sn-1 or sn-2 position of glycerophospholipids (By similarity). Shows N-acyltransferase activity, catalyzing the calcium-independent transfer of a fatty acyl group at the sn-1 position of phosphatidylcholine (PC) and other glycerophospholipids to the primary amine of phosphatidylethanolamine (PE), forming N-acylphosphatidylethanolamine (NAPE), which serves as precursor for N-acylethanolamines (NAEs) (PubMed:19000777).By similarity1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei137PROSITE-ProRule annotation1
Active sitei149PROSITE-ProRule annotation1
Active sitei224Acyl-thioester intermediatePROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionAcyltransferase, Hydrolase, Transferase

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-1482839, Acyl chain remodelling of PE

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...SwissLipidsi		SLP:000001127 [Q9CPX5-4]

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Phospholipase A and acyltransferase 5By similarity
Alternative name(s):
Ca(2+)-independent N-acyltransferase1 Publication (EC:2.3.1.-1 Publication, EC:3.1.1.321 Publication, EC:3.1.1.41 Publication)
Short name:
iNAT1 Publication
H-rev107-like protein 5
HRAS-like suppressor 5Imported
Short name:
HRSL5
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Plaat5Imported
Synonyms:Hrasls5Imported, Hrlp5
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:1913977, Plaat5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001524891 – 270Phospholipase A and acyltransferase 5Add BLAST270

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9CPX5

PRoteomics IDEntifications database

More...PRIDEi		Q9CPX5

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9CPX5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 4 shows highest expression level in testis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000024973, Expressed in testis and 58 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9CPX5, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9CPX5, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000025929

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9CPX5, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9CPX5

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini127 – 240LRATPROSITE-ProRule annotationAdd BLAST114

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the H-rev107 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502S0JN, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000162436

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_070482_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9CPX5

Identification of Orthologs from Complete Genome Data

More...OMAi		TGPKDQP

Database of Orthologous Groups

More...OrthoDBi		1602481at2759

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR007053, LRAT_dom

Pfam protein domain database

More...Pfami		View protein in Pfam
PF04970, LRAT, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51934, LRAT, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9CPX5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGLSPAASGE FGIRLSRVPW PRPTQISKTS STESSDTQSA TGQSTVPHSD 
        60         70         80         90        100
SASSQALLVQ FLPKQLKQDR RLEQARSFQQ GEKPETSLEL TPSKKRTELI 
       110        120        130        140        150
PTSNSEIEST QKNQAVEGNP RPRPGDLIEI FRIGYEHWAI YVEDDCVVHL 
       160        170        180        190        200
APPSEFEAGS ITSIFSNRAV VKYSRLEDVL HGCSWKINNK LDGTYLPLPV 
       210        220        230        240        250
DKIMQRTKNM INKIVQYSLI EGNCEHFVND LRYGVPRSQQ VEHALVEGAK 
       260        270
AAGAVLSAVV DSIRPKPITA
Length:270
Mass (Da):29,866
Last modified:January 31, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i158034CF485288F7
GO
Isoform 2 (identifier: Q9CPX5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     242-270: EHALVEGAKAAGAVLSAVVDSIRPKPITA → YFVELGNHRKHSENLLRTFPVMKNSP

Show »
Length:267
Mass (Da):30,109
Checksum:iE6D6B13F2CB740A2
GO
Isoform 3 (identifier: Q9CPX5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MIPGLGGPWSAPPCRRVVPAGPSGM
     118-151: GNPRPRPGDLIEIFRIGYEHWAIYVEDDCVVHLA → VRIPGIHRMSVLVSWSLLTASCFTLRLINICTDM
     152-270: Missing.

Show »
Length:175
Mass (Da):18,970
Checksum:i035B1BA618A4CD13
GO
Isoform 4 (identifier: Q9CPX5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MIPGLGGPWSAPPCRRVVPAGPSGM

Show »
Length:294
Mass (Da):32,208
Checksum:iEC853146FAE69BBC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3YZK9D3YZK9_MOUSE
Phospholipase A and acyltransferase...
Plaat5 Hrasls5
316Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti21P → S in BAB24741 (PubMed:16141072).Curated1
Sequence conflicti180L → Q in BAB24741 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0446231M → MIPGLGGPWSAPPCRRVVPA GPSGM in isoform 4 and isoform 3. 4 Publications1
Alternative sequenceiVSP_007448118 – 151GNPRP…VVHLA → VRIPGIHRMSVLVSWSLLTA SCFTLRLINICTDM in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_007449152 – 270Missing in isoform 3. 1 PublicationAdd BLAST119
Alternative sequenceiVSP_007450242 – 270EHALV…KPITA → YFVELGNHRKHSENLLRTFP VMKNSP in isoform 2. 1 PublicationAdd BLAST29

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB447517 mRNA Translation: BAH11080.1
AB261168 mRNA Translation: BAF41149.1
AK006527 mRNA Translation: BAB24636.2
AK006790 mRNA Translation: BAB24741.1
AK007015 mRNA Translation: BAB24828.1
AK014971 mRNA Translation: BAB29646.1
AC109225 Genomic DNA No translation available.
CH466612 Genomic DNA Translation: EDL33320.1
BC061008 mRNA Translation: AAH61008.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS29530.1 [Q9CPX5-1]

NCBI Reference Sequences

More...RefSeqi		NP_080007.1, NM_025731.2 [Q9CPX5-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000025929; ENSMUSP00000025929; ENSMUSG00000024973 [Q9CPX5-1]
ENSMUST00000239394; ENSMUSP00000159309; ENSMUSG00000024973 [Q9CPX5-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		66727

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:66727

UCSC genome browser

More...UCSCi		uc008glm.1, mouse [Q9CPX5-3]
uc008gln.1, mouse [Q9CPX5-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB447517 mRNA Translation: BAH11080.1
AB261168 mRNA Translation: BAF41149.1
AK006527 mRNA Translation: BAB24636.2
AK006790 mRNA Translation: BAB24741.1
AK007015 mRNA Translation: BAB24828.1
AK014971 mRNA Translation: BAB29646.1
AC109225 Genomic DNA No translation available.
CH466612 Genomic DNA Translation: EDL33320.1
BC061008 mRNA Translation: AAH61008.1
CCDSiCCDS29530.1 [Q9CPX5-1]
RefSeqiNP_080007.1, NM_025731.2 [Q9CPX5-1]

3D structure databases

SMRiQ9CPX5
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000025929

Chemistry databases

SwissLipidsiSLP:000001127 [Q9CPX5-4]

PTM databases

iPTMnetiQ9CPX5

Proteomic databases

PaxDbiQ9CPX5
PRIDEiQ9CPX5

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		43875, 81 antibodies

Genome annotation databases

EnsembliENSMUST00000025929; ENSMUSP00000025929; ENSMUSG00000024973 [Q9CPX5-1]
ENSMUST00000239394; ENSMUSP00000159309; ENSMUSG00000024973 [Q9CPX5-4]
GeneIDi66727
KEGGimmu:66727
UCSCiuc008glm.1, mouse [Q9CPX5-3]
uc008gln.1, mouse [Q9CPX5-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		117245
MGIiMGI:1913977, Plaat5

Phylogenomic databases

eggNOGiENOG502S0JN, Eukaryota
GeneTreeiENSGT00940000162436
HOGENOMiCLU_070482_0_0_1
InParanoidiQ9CPX5
OMAiTGPKDQP
OrthoDBi1602481at2759

Enzyme and pathway databases

ReactomeiR-MMU-1482839, Acyl chain remodelling of PE

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		66727, 0 hits in 17 CRISPR screens

Protein Ontology

More...PROi		PR:Q9CPX5
RNActiQ9CPX5, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000024973, Expressed in testis and 58 other tissues
ExpressionAtlasiQ9CPX5, baseline and differential
GenevisibleiQ9CPX5, MM

Family and domain databases

InterProiView protein in InterPro
IPR007053, LRAT_dom
PfamiView protein in Pfam
PF04970, LRAT, 1 hit
PROSITEiView protein in PROSITE
PS51934, LRAT, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPLAT5_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9CPX5
Secondary accession number(s): Q6P8Y6, Q9CVQ2, Q9CVS0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 31, 2002
Last sequence update: January 31, 2002
Last modified: February 10, 2021
This is version 117 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again