Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 132 (08 May 2019)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Palmitoyltransferase ZDHHC6

Gene

Zdhhc6

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Endoplasmic reticulum palmitoyl acyltransferase that mediates palmitoylation of proteins such as AMFR, CALX, ITPR1 and TFRC (PubMed:25368151). Palmitoylates calnexin (CALX), which is required for its association with the ribosome-translocon complex and efficient folding of glycosylated proteins (By similarity). Mediates palmitoylation of AMFR, promoting AMFR distribution to the peripheral endoplasmic reticulum (By similarity). Together with SELENOK, palmitoylates ITPR1 in immune cells, leading to regulate ITPR1 stability and function (PubMed:25368151).By similarity1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei129S-palmitoyl cysteine intermediateBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionAcyltransferase, Transferase

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Palmitoyltransferase ZDHHC6Curated (EC:2.3.1.225By similarity)
Alternative name(s):
Zinc finger DHHC domain-containing protein 6By similarity
Short name:
DHHC-6By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Zdhhc6Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1914230 Zdhhc6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei25 – 45HelicalSequence analysisAdd BLAST21
Transmembranei58 – 78HelicalSequence analysisAdd BLAST21
Transmembranei144 – 164HelicalSequence analysisAdd BLAST21
Transmembranei195 – 215HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002128721 – 413Palmitoyltransferase ZDHHC6Add BLAST413

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi328S-palmitoyl cysteineBy similarity1
Lipidationi329S-palmitoyl cysteineBy similarity1
Lipidationi343S-palmitoyl cysteineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Palmitoylated at 3 different sites by ZDHHC16. The combination of the different palmitoylation events strongly affects the quaternary assembly of ZDHHC6, its localization, stability and function. Palmitoylation at Cys-328 accelerates the turnover of ZDHHC6. Depalmitoylated by LYPLA2.By similarity1 Publication

Keywords - PTMi

Lipoprotein, Palmitate

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9CPV7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9CPV7

PeptideAtlas

More...
PeptideAtlasi
Q9CPV7

PRoteomics IDEntifications database

More...
PRIDEi
Q9CPV7

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9CPV7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9CPV7

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9CPV7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000024982 Expressed in 286 organ(s), highest expression level in metanephric renal vesicle

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9CPV7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9CPV7 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homooligomerizes (By similarity). Interacts with SELENOK (PubMed:25368151).By similarity1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
211853, 8 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000076157

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini99 – 149DHHCPROSITE-ProRule annotationAdd BLAST51
Domaini313 – 398SH3PROSITE-ProRule annotationAdd BLAST86

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi410 – 413Di-lysine motifBy similarity4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The DHHC domain is required for palmitoyltransferase activity.By similarity
The C-terminal di-lysine motif confers endoplasmic reticulum localization.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the DHHC palmitoyltransferase family.Curated

Keywords - Domaini

SH3 domain, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1314 Eukaryota
COG5273 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155642

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000017896

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9CPV7

KEGG Orthology (KO)

More...
KOi
K20031

Identification of Orthologs from Complete Genome Data

More...
OMAi
RVRSVQY

Database of Orthologous Groups

More...
OrthoDBi
1491968at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9CPV7

TreeFam database of animal gene trees

More...
TreeFami
TF320809

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001594 Palmitoyltrfase_DHHC
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01529 DHHC, 1 hit
PF07653 SH3_2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50044 SSF50044, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50216 DHHC, 1 hit
PS50002 SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Experimental confirmation may be lacking for some isoforms.

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9CPV7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGIFCSVIKF ENLQDLRRLC HWGPIIALGV IAICSTMAMI DSVLWYWPLH
60 70 80 90 100
TTGGSVNFIM LINWTVMILY NYFNAMFAGP GFVPRGWKPE KSQDSMYLQY
110 120 130 140 150
CKVCQAYKAP RSHHCRKCNR CVMKMDHHCP WINNCCGHQN HASFTLFLLL
160 170 180 190 200
APLGCTHAAF IFVMTMYTQL YNRLSFGWNT VKIDMSAARR DPPPIVPFGL
210 220 230 240 250
AAFAATLFAL GLALGTTIAV GMLFFIQIKI ILRNKTSIES WIEEKAKDRI
260 270 280 290 300
QYYQLDEVFI FPYDMGSKWK NFKQVFTWSG VPEGDGLEWP IREGCDQYSL
310 320 330 340 350
TIEQLKQKAD KRVRSVRYKV IEDYNGACCP LNRGVRTFFT SPCTEEPRIR
360 370 380 390 400
LQKGEFILAT RGLRYWLYGD KILDDSFIEG TSRVRGWFPR NCVEKCPCDG
410
DSDPAPEGEK KNR
Length:413
Mass (Da):47,527
Last modified:June 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF1A491B4F9DDDB4C
GO
Isoform 2 (identifier: Q9CPV7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     381-399: TSRVRGWFPRNCVEKCPCD → SHCVTQPQTCSALALAS
     400-413: Missing.

Show »
Length:397
Mass (Da):45,509
Checksum:iA06069DA5312007E
GO
Isoform 3 (identifier: Q9CPV7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     380-413: GTSRVRGWFPRNCVEKCPCDGDSDPAPEGEKKNR → DQDVELSAPSPAPCLPRCCHVSHHDDNGLNL

Show »
Length:410
Mass (Da):47,076
Checksum:i42B055383E81C9F6
GO
Isoform 4 (identifier: Q9CPV7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     381-413: TSRVRGWFPRNCVEKCPCDGDSDPAPEGEKKNR → VSVEKKKSTIAWNLIAESLALQKKKVSKPKIVFDMEHRGVV

Note: No experimental confirmation available.
Show »
Length:421
Mass (Da):48,429
Checksum:i4349AA1101E78424
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A286YE37A0A286YE37_MOUSE
Palmitoyltransferase ZDHHC6
Zdhhc6
144Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti269W → R in BAC28968 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_006941380 – 413GTSRV…EKKNR → DQDVELSAPSPAPCLPRCCH VSHHDDNGLNL in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_016270381 – 413TSRVR…EKKNR → VSVEKKKSTIAWNLIAESLA LQKKKVSKPKIVFDMEHRGV V in isoform 4. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_006939381 – 399TSRVR…KCPCD → SHCVTQPQTCSALALAS in isoform 2. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_006940400 – 413Missing in isoform 2. 1 PublicationAdd BLAST14

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK011373 mRNA Translation: BAB27576.1
AK010296 mRNA Translation: BAB26831.1
AK077693 mRNA Translation: BAC36960.1
AK050388 mRNA Translation: BAC34229.1
AK035172 mRNA Translation: BAC28968.1
AK038177 mRNA Translation: BAC29944.1
AK077838 mRNA Translation: BAC37027.1
AK139707 mRNA Translation: BAE24110.1
AK144128 mRNA Translation: BAE25717.1
AK154741 mRNA Translation: BAE32798.1
AK157494 mRNA Translation: BAE34103.1
AK159304 mRNA Translation: BAE34974.1
BC033317 mRNA Translation: AAH33317.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS29909.1 [Q9CPV7-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001028745.1, NM_001033573.1 [Q9CPV7-1]
NP_080159.3, NM_025883.3 [Q9CPV7-1]
XP_006527331.1, XM_006527268.2 [Q9CPV7-1]
XP_011245618.1, XM_011247316.1 [Q9CPV7-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000076891; ENSMUSP00000076157; ENSMUSG00000024982 [Q9CPV7-1]
ENSMUST00000224291; ENSMUSP00000153221; ENSMUSG00000024982 [Q9CPV7-4]
ENSMUST00000224897; ENSMUSP00000153014; ENSMUSG00000024982 [Q9CPV7-1]
ENSMUST00000225495; ENSMUSP00000152962; ENSMUSG00000024982 [Q9CPV7-2]
ENSMUST00000225963; ENSMUSP00000153159; ENSMUSG00000024982 [Q9CPV7-3]
ENSMUST00000226103; ENSMUSP00000153404; ENSMUSG00000024982 [Q9CPV7-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
66980

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:66980

UCSC genome browser

More...
UCSCi
uc008hxs.2 mouse [Q9CPV7-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK011373 mRNA Translation: BAB27576.1
AK010296 mRNA Translation: BAB26831.1
AK077693 mRNA Translation: BAC36960.1
AK050388 mRNA Translation: BAC34229.1
AK035172 mRNA Translation: BAC28968.1
AK038177 mRNA Translation: BAC29944.1
AK077838 mRNA Translation: BAC37027.1
AK139707 mRNA Translation: BAE24110.1
AK144128 mRNA Translation: BAE25717.1
AK154741 mRNA Translation: BAE32798.1
AK157494 mRNA Translation: BAE34103.1
AK159304 mRNA Translation: BAE34974.1
BC033317 mRNA Translation: AAH33317.1
CCDSiCCDS29909.1 [Q9CPV7-1]
RefSeqiNP_001028745.1, NM_001033573.1 [Q9CPV7-1]
NP_080159.3, NM_025883.3 [Q9CPV7-1]
XP_006527331.1, XM_006527268.2 [Q9CPV7-1]
XP_011245618.1, XM_011247316.1 [Q9CPV7-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi211853, 8 interactors
STRINGi10090.ENSMUSP00000076157

PTM databases

iPTMnetiQ9CPV7
PhosphoSitePlusiQ9CPV7
SwissPalmiQ9CPV7

Proteomic databases

EPDiQ9CPV7
PaxDbiQ9CPV7
PeptideAtlasiQ9CPV7
PRIDEiQ9CPV7

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000076891; ENSMUSP00000076157; ENSMUSG00000024982 [Q9CPV7-1]
ENSMUST00000224291; ENSMUSP00000153221; ENSMUSG00000024982 [Q9CPV7-4]
ENSMUST00000224897; ENSMUSP00000153014; ENSMUSG00000024982 [Q9CPV7-1]
ENSMUST00000225495; ENSMUSP00000152962; ENSMUSG00000024982 [Q9CPV7-2]
ENSMUST00000225963; ENSMUSP00000153159; ENSMUSG00000024982 [Q9CPV7-3]
ENSMUST00000226103; ENSMUSP00000153404; ENSMUSG00000024982 [Q9CPV7-1]
GeneIDi66980
KEGGimmu:66980
UCSCiuc008hxs.2 mouse [Q9CPV7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
64429
MGIiMGI:1914230 Zdhhc6

Phylogenomic databases

eggNOGiKOG1314 Eukaryota
COG5273 LUCA
GeneTreeiENSGT00940000155642
HOGENOMiHOG000017896
InParanoidiQ9CPV7
KOiK20031
OMAiRVRSVQY
OrthoDBi1491968at2759
PhylomeDBiQ9CPV7
TreeFamiTF320809

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Zdhhc6 mouse

Protein Ontology

More...
PROi
PR:Q9CPV7

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000024982 Expressed in 286 organ(s), highest expression level in metanephric renal vesicle
ExpressionAtlasiQ9CPV7 baseline and differential
GenevisibleiQ9CPV7 MM

Family and domain databases

InterProiView protein in InterPro
IPR001594 Palmitoyltrfase_DHHC
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PfamiView protein in Pfam
PF01529 DHHC, 1 hit
PF07653 SH3_2, 1 hit
SUPFAMiSSF50044 SSF50044, 1 hit
PROSITEiView protein in PROSITE
PS50216 DHHC, 1 hit
PS50002 SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZDHC6_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9CPV7
Secondary accession number(s): Q3U3I8, Q3UT70, Q544H1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 2003
Last sequence update: June 1, 2001
Last modified: May 8, 2019
This is version 132 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again