Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 139 (29 Sep 2021)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Add a publicationFeedback
Protein

Glyoxalase domain-containing protein 4

Gene

Glod4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Glyoxalase domain-containing protein 4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Glod4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1914451, Glod4

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSMUSG00000017286

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Mitochondrion

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002803921 – 298Glyoxalase domain-containing protein 4Add BLAST298

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei109N6-succinyllysineCombined sources1
Modified residuei131PhosphoserineCombined sources1
Modified residuei273N6-succinyllysineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

The CPTAC Assay portal

More...
CPTACi
non-CPTAC-3812

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9CPV4

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9CPV4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9CPV4

PeptideAtlas

More...
PeptideAtlasi
Q9CPV4

PRoteomics IDEntifications database

More...
PRIDEi
Q9CPV4

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
266812 [Q9CPV4-1]
266813 [Q9CPV4-2]
266814 [Q9CPV4-3]

2D gel databases

REPRODUCTION-2DPAGE

More...
REPRODUCTION-2DPAGEi
Q9CPV4

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9CPV4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9CPV4

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9CPV4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000017286, Expressed in embryonic stem cell and 311 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9CPV4, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9CPV4, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with NUDT9.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
212012, 2 interactors

Protein interaction database and analysis system

More...
IntActi
Q9CPV4, 1 interactor

Molecular INTeraction database

More...
MINTi
Q9CPV4

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000017430

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9CPV4, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9CPV4

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini5 – 130VOC 1PROSITE-ProRule annotationAdd BLAST126
Domaini137 – 258VOC 2PROSITE-ProRule annotationAdd BLAST122

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the glyoxalase I family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2943, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000012340

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9CPV4

Identification of Orthologs from Complete Genome Data

More...
OMAi
CEAACNG

Database of Orthologous Groups

More...
OrthoDBi
824414at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9CPV4

TreeFam database of animal gene trees

More...
TreeFami
TF105801

Family and domain databases

Conserved Domains Database

More...
CDDi
cd16357, GLOD4_C, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.10.180.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR043193, GLOD4
IPR043194, GLOD4_C
IPR029068, Glyas_Bleomycin-R_OHBP_Dase
IPR037523, VOC

The PANTHER Classification System

More...
PANTHERi
PTHR46466, PTHR46466, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54593, SSF54593, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51819, VOC, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9CPV4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATRRALHFV FKVKNRFQTV HFFRDVLGMQ VLRHEEFEEG CKAACNGPYD
60 70 80 90 100
GKWSKTMVGF GPEDDHFVAE LTYNYGIGDY KLGNDFMGIT LASSQAVSNA
110 120 130 140 150
RKLEWPLSKV AEGIFETEAP GGYKFYLQDR SPSQSDPVLK VTLAVSDLQK
160 170 180 190 200
SLNYWSNLLG MKIYEQDEEK QRALLGYADN QCKLELQGIQ GAVDHAAAFG
210 220 230 240 250
RIAFSCPQKE LPDLEDLMKR ESHSILTPLV SLDTPGKATV QVVILADPDG
260 270 280 290
HEICFVGDEA FRELSKMDPK GSKLLDDAME ADKSDEWFAT RNKPKASG
Length:298
Mass (Da):33,317
Last modified:June 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF2CD5FD2387A78CE
GO
Isoform 2 (identifier: Q9CPV4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     278-291: AMEADKSDEWFATR → GEGCTDRVRTANPG
     292-298: Missing.

Show »
Length:291
Mass (Da):32,410
Checksum:i7B6307C470BEBD74
GO
Isoform 3 (identifier: Q9CPV4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MATRRALHFVFKVKNRFQTVHFFRDVLGMQ → MICGSVLNSPD

Show »
Length:279
Mass (Da):30,771
Checksum:i974664AC560AB451
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9Q197E9Q197_MOUSE
Glyoxalase domain-containing protei...
Glod4
279Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q055E9Q055_MOUSE
Glyoxalase domain-containing protei...
Glod4
61Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6ZTG3F6ZTG3_MOUSE
Glyoxalase domain-containing protei...
Glod4
212Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q2R6E9Q2R6_MOUSE
Glyoxalase domain-containing protei...
Glod4
66Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F7BB55F7BB55_MOUSE
Glyoxalase domain-containing protei...
Glod4
97Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti46N → Y in BAB27311 (PubMed:16141072).Curated1
Sequence conflicti84N → K in BAB24818 (PubMed:16141072).Curated1
Sequence conflicti214L → I in BAB27311 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0236491 – 30MATRR…VLGMQ → MICGSVLNSPD in isoform 3. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_023650278 – 291AMEAD…WFATR → GEGCTDRVRTANPG in isoform 2. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_023651292 – 298Missing in isoform 2. 1 Publication7

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK006979 mRNA Translation: BAB24818.1
AK010992 mRNA Translation: BAB27311.1
AK012569 mRNA Translation: BAB28324.1
AK013212 mRNA Translation: BAB28716.1
AK138073 mRNA Translation: BAE23546.1
AL591129 Genomic DNA No translation available.
BC061012 mRNA Translation: AAH61012.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS25063.1 [Q9CPV4-1]
CCDS88193.1 [Q9CPV4-3]

NCBI Reference Sequences

More...
RefSeqi
NP_080305.2, NM_026029.3 [Q9CPV4-1]
XP_006534033.1, XM_006533970.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000017430; ENSMUSP00000017430; ENSMUSG00000017286 [Q9CPV4-1]
ENSMUST00000170710; ENSMUSP00000131788; ENSMUSG00000017286 [Q9CPV4-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
67201

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:67201

UCSC genome browser

More...
UCSCi
uc007kfc.2, mouse [Q9CPV4-2]
uc007kfl.2, mouse [Q9CPV4-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK006979 mRNA Translation: BAB24818.1
AK010992 mRNA Translation: BAB27311.1
AK012569 mRNA Translation: BAB28324.1
AK013212 mRNA Translation: BAB28716.1
AK138073 mRNA Translation: BAE23546.1
AL591129 Genomic DNA No translation available.
BC061012 mRNA Translation: AAH61012.1
CCDSiCCDS25063.1 [Q9CPV4-1]
CCDS88193.1 [Q9CPV4-3]
RefSeqiNP_080305.2, NM_026029.3 [Q9CPV4-1]
XP_006534033.1, XM_006533970.3

3D structure databases

SMRiQ9CPV4
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi212012, 2 interactors
IntActiQ9CPV4, 1 interactor
MINTiQ9CPV4
STRINGi10090.ENSMUSP00000017430

PTM databases

iPTMnetiQ9CPV4
PhosphoSitePlusiQ9CPV4
SwissPalmiQ9CPV4

2D gel databases

REPRODUCTION-2DPAGEiQ9CPV4

Proteomic databases

CPTACinon-CPTAC-3812
EPDiQ9CPV4
jPOSTiQ9CPV4
PaxDbiQ9CPV4
PeptideAtlasiQ9CPV4
PRIDEiQ9CPV4
ProteomicsDBi266812 [Q9CPV4-1]
266813 [Q9CPV4-2]
266814 [Q9CPV4-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
10285, 109 antibodies

The DNASU plasmid repository

More...
DNASUi
67201

Genome annotation databases

EnsembliENSMUST00000017430; ENSMUSP00000017430; ENSMUSG00000017286 [Q9CPV4-1]
ENSMUST00000170710; ENSMUSP00000131788; ENSMUSG00000017286 [Q9CPV4-3]
GeneIDi67201
KEGGimmu:67201
UCSCiuc007kfc.2, mouse [Q9CPV4-2]
uc007kfl.2, mouse [Q9CPV4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51031
MGIiMGI:1914451, Glod4
VEuPathDBiHostDB:ENSMUSG00000017286

Phylogenomic databases

eggNOGiKOG2943, Eukaryota
GeneTreeiENSGT00390000012340
InParanoidiQ9CPV4
OMAiCEAACNG
OrthoDBi824414at2759
PhylomeDBiQ9CPV4
TreeFamiTF105801

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
67201, 1 hit in 61 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Glod4, mouse

Protein Ontology

More...
PROi
PR:Q9CPV4
RNActiQ9CPV4, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000017286, Expressed in embryonic stem cell and 311 other tissues
ExpressionAtlasiQ9CPV4, baseline and differential
GenevisibleiQ9CPV4, MM

Family and domain databases

CDDicd16357, GLOD4_C, 1 hit
Gene3Di3.10.180.10, 2 hits
InterProiView protein in InterPro
IPR043193, GLOD4
IPR043194, GLOD4_C
IPR029068, Glyas_Bleomycin-R_OHBP_Dase
IPR037523, VOC
PANTHERiPTHR46466, PTHR46466, 1 hit
SUPFAMiSSF54593, SSF54593, 1 hit
PROSITEiView protein in PROSITE
PS51819, VOC, 2 hits

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGLOD4_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9CPV4
Secondary accession number(s): Q3UUS8, Q9CY26, Q9D9F5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: June 1, 2001
Last modified: September 29, 2021
This is version 139 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again