Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Glyoxalase domain-containing protein 4

Gene

Glod4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Glyoxalase domain-containing protein 4
Gene namesi
Name:Glod4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:1914451 Glod4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Mitochondrion

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002803921 – 298Glyoxalase domain-containing protein 4Add BLAST298

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei109N6-succinyllysineCombined sources1
Modified residuei131PhosphoserineCombined sources1
Modified residuei273N6-succinyllysineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9CPV4
PaxDbiQ9CPV4
PeptideAtlasiQ9CPV4
PRIDEiQ9CPV4

2D gel databases

REPRODUCTION-2DPAGEiQ9CPV4

PTM databases

iPTMnetiQ9CPV4
PhosphoSitePlusiQ9CPV4

Expressioni

Gene expression databases

BgeeiENSMUSG00000017286
CleanExiMM_GLOD4
ExpressionAtlasiQ9CPV4 baseline and differential
GenevisibleiQ9CPV4 MM

Interactioni

Subunit structurei

Interacts with NUDT9.By similarity

Protein-protein interaction databases

IntActiQ9CPV4, 4 interactors
MINTiQ9CPV4
STRINGi10090.ENSMUSP00000017430

Structurei

3D structure databases

ProteinModelPortaliQ9CPV4
SMRiQ9CPV4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini5 – 130VOC 1PROSITE-ProRule annotationAdd BLAST126
Domaini137 – 258VOC 2PROSITE-ProRule annotationAdd BLAST122

Sequence similaritiesi

Belongs to the glyoxalase I family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410IRT7 Eukaryota
ENOG410XP3J LUCA
GeneTreeiENSGT00390000012340
HOGENOMiHOG000006776
HOVERGENiHBG056038
InParanoidiQ9CPV4
OMAiCEAACNG
OrthoDBiEOG091G0EHY
PhylomeDBiQ9CPV4
TreeFamiTF105801

Family and domain databases

Gene3Di3.10.180.10, 2 hits
InterProiView protein in InterPro
IPR029068 Glyas_Bleomycin-R_OHBP_Dase
IPR037523 VOC
SUPFAMiSSF54593 SSF54593, 1 hit
PROSITEiView protein in PROSITE
PS51819 VOC, 2 hits

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9CPV4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATRRALHFV FKVKNRFQTV HFFRDVLGMQ VLRHEEFEEG CKAACNGPYD
60 70 80 90 100
GKWSKTMVGF GPEDDHFVAE LTYNYGIGDY KLGNDFMGIT LASSQAVSNA
110 120 130 140 150
RKLEWPLSKV AEGIFETEAP GGYKFYLQDR SPSQSDPVLK VTLAVSDLQK
160 170 180 190 200
SLNYWSNLLG MKIYEQDEEK QRALLGYADN QCKLELQGIQ GAVDHAAAFG
210 220 230 240 250
RIAFSCPQKE LPDLEDLMKR ESHSILTPLV SLDTPGKATV QVVILADPDG
260 270 280 290
HEICFVGDEA FRELSKMDPK GSKLLDDAME ADKSDEWFAT RNKPKASG
Length:298
Mass (Da):33,317
Last modified:June 1, 2001 - v1
Checksum:iF2CD5FD2387A78CE
GO
Isoform 2 (identifier: Q9CPV4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     278-291: AMEADKSDEWFATR → GEGCTDRVRTANPG
     292-298: Missing.

Show »
Length:291
Mass (Da):32,410
Checksum:i7B6307C470BEBD74
GO
Isoform 3 (identifier: Q9CPV4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MATRRALHFVFKVKNRFQTVHFFRDVLGMQ → MICGSVLNSPD

Show »
Length:279
Mass (Da):30,771
Checksum:i974664AC560AB451
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti46N → Y in BAB27311 (PubMed:16141072).Curated1
Sequence conflicti84N → K in BAB24818 (PubMed:16141072).Curated1
Sequence conflicti214L → I in BAB27311 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0236491 – 30MATRR…VLGMQ → MICGSVLNSPD in isoform 3. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_023650278 – 291AMEAD…WFATR → GEGCTDRVRTANPG in isoform 2. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_023651292 – 298Missing in isoform 2. 1 Publication7

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK006979 mRNA Translation: BAB24818.1
AK010992 mRNA Translation: BAB27311.1
AK012569 mRNA Translation: BAB28324.1
AK013212 mRNA Translation: BAB28716.1
AK138073 mRNA Translation: BAE23546.1
AL591129 Genomic DNA No translation available.
BC061012 mRNA Translation: AAH61012.1
CCDSiCCDS25063.1 [Q9CPV4-1]
RefSeqiNP_080305.2, NM_026029.3 [Q9CPV4-1]
XP_006534033.1, XM_006533970.3 [Q9CPV4-3]
UniGeneiMm.482113

Genome annotation databases

EnsembliENSMUST00000017430; ENSMUSP00000017430; ENSMUSG00000017286 [Q9CPV4-1]
ENSMUST00000170710; ENSMUSP00000131788; ENSMUSG00000017286 [Q9CPV4-3]
GeneIDi67201
KEGGimmu:67201
UCSCiuc007kfc.2 mouse [Q9CPV4-2]
uc007kfl.2 mouse [Q9CPV4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiGLOD4_MOUSE
AccessioniPrimary (citable) accession number: Q9CPV4
Secondary accession number(s): Q3UUS8, Q9CY26, Q9D9F5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: June 1, 2001
Last modified: July 18, 2018
This is version 123 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health