Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 133 (12 Aug 2020)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Chaperonin 60 subunit beta 4, chloroplastic

Gene

CPN60B4

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved specifically in the folding of NDHH, a subunit of the chloroplast NADH dehydrogenase-like complex (NDH).3 Publications

Miscellaneous

CPN60B1, CPN60B2 or CPN60B3 cannot complement the function of CPN60B4.
Assisted protein folding requires ATP hydrolysis, but not K+ ions.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • protein folding Source: TAIR
  • protein refolding Source: InterPro

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChaperone
LigandATP-binding, Nucleotide-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Chaperonin 60 subunit beta 4, chloroplastic
Short name:
CPN-60 beta 4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CPN60B4
Synonyms:Cpn60-B(4)
Ordered Locus Names:At1g26230
ORF Names:F28B23.11
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliopsidaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Arabidopsis Information Portal

More...
Araporti
AT1G26230

The Arabidopsis Information Resource

More...
TAIRi
locus:2028751, AT1G26230

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Chloroplast, Plastid

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

No visible phenotype besides impaired NDH activity.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – 37ChloroplastSequence analysisAdd BLAST37
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000041368638 – 611Chaperonin 60 subunit beta 4, chloroplasticAdd BLAST574

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9C667

PRoteomics IDEntifications database

More...
PRIDEi
Q9C667

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
220333 [Q9C667-1]

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated by light.1 Publication

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9C667, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9C667, AT

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Part of the Cpn60 complex composed of 7 alpha and 7 beta subunits. Can also form a complex composed of 14 beta subunits only. Both complexes show ATPase activity. The Cpn60 complex interacts with the Cpn10 complex.

Interacts with NDHH.

2 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
24401, 1 interactor

STRING: functional protein association networks

More...
STRINGi
3702.AT1G26230.1

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9C667

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili377 – 480Sequence analysisAdd BLAST104

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The C-terminus (568-611) is required for efficient NDHH folding, but not for the formation of the chaperonin complex.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the chaperonin (HSP60) family.Curated

Keywords - Domaini

Coiled coil, Transit peptide

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0356, Eukaryota

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9C667

KEGG Orthology (KO)

More...
KOi
K04077

Identification of Orthologs from Complete Genome Data

More...
OMAi
NMEQKIG

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9C667

Family and domain databases

Conserved Domains Database

More...
CDDi
cd03344, GroEL, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.560.10, 1 hit
3.30.260.10, 1 hit
3.50.7.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001844, Chaprnin_Cpn60
IPR002423, Cpn60/TCP-1
IPR027409, GroEL-like_apical_dom_sf
IPR027413, GROEL-like_equatorial_sf
IPR027410, TCP-1-like_intermed_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00118, Cpn60_TCP1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00298, CHAPERONIN60

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48592, SSF48592, 1 hit
SSF52029, SSF52029, 1 hit
SSF54849, SSF54849, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR02348, GroEL, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9C667-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAFSQAALSA LPLSDRTFRK KPSSSSSSSP NFVLRVRAAA KEVHFNRDGS
60 70 80 90 100
VTKKLQAGAD MVAKLLGVTL GPKGRNVVLQ NKYGPPRIVN DGETVLKEIE
110 120 130 140 150
LEDPLENVGV KLVRQAGAKT NDLAGDGSTT SIILAHGLIT EGIKVISAGT
160 170 180 190 200
NPIQVARGIE KTTKALVLEL KSMSREIEDH ELAHVAAVSA GNDYEVGNMI
210 220 230 240 250
SNAFQQVGRT GVVTIEKGKY LVNNLEIVEG MQFNRGYLSP YFVTDRRKRE
260 270 280 290 300
AEFHDCKLLL VDKKITNPKD MFKILDSAVK EEFPVLIVAE DIEQDALAPV
310 320 330 340 350
IRNKLKGNLK VAAIKAPAFG ERKSHCLDDL AIFTGATVIR DEMGLSLEKA
360 370 380 390 400
GKEVLGTAKR VLVTKDSTLI VTNGFTQKAV DERVSQIKNL IENTEENFQK
410 420 430 440 450
KILNERVARL SGGIAIIQVG ALTQVELKDK QLKVEDALNA TKSAIEEGIV
460 470 480 490 500
VGGGCALLRL ATKVDRIKET LDNTEQKIGA EIFKKALSYP IRLIAKNADT
510 520 530 540 550
NGNIVIEKVL SNKNTMYGYN AAKNQYEDLM LAGIIDPTKV VRCCLEHASS
560 570 580 590 600
VAQTFLTSDC VVVEIKEIKP RPIINPPLPT SSPATSSMFP DRKLPRFPQI
610
MPRTRSHFPR K
Length:611
Mass (Da):66,796
Last modified:June 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD7CA90E3F5632CBE
GO
Isoform 2 (identifier: Q9C667-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MAFSQAALSALPLSDRTFRKKPSSSSSSSPNFVLRVRAAAKEVHFNRDGSVTKKLQ → MVVK

Show »
Length:559
Mass (Da):61,163
Checksum:iD49526CFC286D28E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1P8ATA4A0A1P8ATA4_ARATH
TCP-1/cpn60 chaperonin family prote...
Cpn60beta4 chaperonin-60beta4, At1g26230, F28B23.11, F28B23_11
551Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2H1ZEC4A0A2H1ZEC4_ARATH
TCP-1/cpn60 chaperonin family prote...
Cpn60beta4 chaperonin-60beta4, At1g26230, F28B23.11, F28B23_11
551Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1P8ATB3A0A1P8ATB3_ARATH
TCP-1/cpn60 chaperonin family prote...
Cpn60beta4 chaperonin-60beta4, At1g26230, F28B23.11, F28B23_11
470Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti394T → N in BAD95277 (Ref. 3) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0419571 – 56MAFSQ…TKKLQ → MVVK in isoform 2. CuratedAdd BLAST56

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC079829 Genomic DNA Translation: AAG50688.1
CP002684 Genomic DNA Translation: AEE30663.1
CP002684 Genomic DNA Translation: ANM59894.1
AK221637 mRNA Translation: BAD95277.1

Protein sequence database of the Protein Information Resource

More...
PIRi
E86388

NCBI Reference Sequences

More...
RefSeqi
NP_001185097.1, NM_001198168.2 [Q9C667-2]
NP_173947.1, NM_102387.3 [Q9C667-1]

Genome annotation databases

Ensembl plant genome annotation project

More...
EnsemblPlantsi
AT1G26230.1; AT1G26230.1; AT1G26230 [Q9C667-1]
AT1G26230.4; AT1G26230.4; AT1G26230 [Q9C667-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
839164

Gramene; a comparative resource for plants

More...
Gramenei
AT1G26230.1; AT1G26230.1; AT1G26230 [Q9C667-1]
AT1G26230.4; AT1G26230.4; AT1G26230 [Q9C667-2]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ath:AT1G26230

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC079829 Genomic DNA Translation: AAG50688.1
CP002684 Genomic DNA Translation: AEE30663.1
CP002684 Genomic DNA Translation: ANM59894.1
AK221637 mRNA Translation: BAD95277.1
PIRiE86388
RefSeqiNP_001185097.1, NM_001198168.2 [Q9C667-2]
NP_173947.1, NM_102387.3 [Q9C667-1]

3D structure databases

SMRiQ9C667
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi24401, 1 interactor
STRINGi3702.AT1G26230.1

Proteomic databases

PaxDbiQ9C667
PRIDEiQ9C667
ProteomicsDBi220333 [Q9C667-1]

Genome annotation databases

EnsemblPlantsiAT1G26230.1; AT1G26230.1; AT1G26230 [Q9C667-1]
AT1G26230.4; AT1G26230.4; AT1G26230 [Q9C667-2]
GeneIDi839164
GrameneiAT1G26230.1; AT1G26230.1; AT1G26230 [Q9C667-1]
AT1G26230.4; AT1G26230.4; AT1G26230 [Q9C667-2]
KEGGiath:AT1G26230

Organism-specific databases

AraportiAT1G26230
TAIRilocus:2028751, AT1G26230

Phylogenomic databases

eggNOGiKOG0356, Eukaryota
InParanoidiQ9C667
KOiK04077
OMAiNMEQKIG
PhylomeDBiQ9C667

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q9C667

Gene expression databases

ExpressionAtlasiQ9C667, baseline and differential
GenevisibleiQ9C667, AT

Family and domain databases

CDDicd03344, GroEL, 1 hit
Gene3Di1.10.560.10, 1 hit
3.30.260.10, 1 hit
3.50.7.10, 1 hit
InterProiView protein in InterPro
IPR001844, Chaprnin_Cpn60
IPR002423, Cpn60/TCP-1
IPR027409, GroEL-like_apical_dom_sf
IPR027413, GROEL-like_equatorial_sf
IPR027410, TCP-1-like_intermed_sf
PfamiView protein in Pfam
PF00118, Cpn60_TCP1, 1 hit
PRINTSiPR00298, CHAPERONIN60
SUPFAMiSSF48592, SSF48592, 1 hit
SSF52029, SSF52029, 1 hit
SSF54849, SSF54849, 1 hit
TIGRFAMsiTIGR02348, GroEL, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCPNB4_ARATH
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9C667
Secondary accession number(s): F4IE47, Q56XN6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 19, 2011
Last sequence update: June 1, 2001
Last modified: August 12, 2020
This is version 133 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again