Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 119 (16 Oct 2019)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Peptide methionine sulfoxide reductase B2, chloroplastic

Gene

MSRB2

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. Specifically reduces the MetSO R-enantiomer. Plays a protective role against oxidative stress by restoring activity to proteins that have been inactivated by methionine oxidation. May play an essential function in association with MSRB1 in maintaining vegetative growth during environmental constraints, through the preservation of photosynthetic antennae. MSRB1 and MSRB2 account for most of the leaf peptide MSR capacity.4 Publications

Miscellaneous

Reduced by thioredoxins f, m, x and y through a dithiol-disulfide exchange involving both redox-active Cys of the two partners.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=54 µM for dabsyl methionine sulfoxide1 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi116ZincPROSITE-ProRule annotation1
    Metal bindingi119ZincPROSITE-ProRule annotation1
    Metal bindingi162ZincPROSITE-ProRule annotation1
    Metal bindingi165ZincPROSITE-ProRule annotation1
    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei187NucleophilePROSITE-ProRule annotation1

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    • metal ion binding Source: UniProtKB-KW
    • peptide-methionine (R)-S-oxide reductase activity Source: UniProtKB

    GO - Biological processi

    • protein repair Source: InterPro
    • response to oxidative stress Source: UniProtKB

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionOxidoreductase
    Biological processElectron transport, Transport
    LigandMetal-binding, Zinc

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Peptide methionine sulfoxide reductase B2, chloroplastic (EC:1.8.4.12)
    Short name:
    AtMSRB2
    Alternative name(s):
    Peptide-methionine (R)-S-oxide reductase
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:MSRB2
    Ordered Locus Names:At4g21860
    ORF Names:T8O5.70
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliopsidaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

    Organism-specific databases

    Arabidopsis Information Portal

    More...
    Araporti
    AT4G21860

    The Arabidopsis Information Resource

    More...
    TAIRi
    locus:2141702 AT4G21860

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Chloroplast, Plastid

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi134C → S or T: Increases activity 2-fold. Abolishes reduction by thioredoxin h. 1 Publication1

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – 63ChloroplastSequence analysisAdd BLAST63
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000039552064 – 202Peptide methionine sulfoxide reductase B2, chloroplasticAdd BLAST139

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi134 ↔ 187Redox-active

    Keywords - PTMi

    Disulfide bond

    Proteomic databases

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    Q9C5C8

    PRoteomics IDEntifications database

    More...
    PRIDEi
    Q9C5C8

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    Q9C5C8

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Expressed in stems, young leaves, floral buds and flowers. Expressed at low levels in roots, mature leaves and siliques (at protein level).1 Publication

    <p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

    By photooxidative stress.1 Publication

    Gene expression databases

    ExpressionAtlas, Differential and Baseline Expression

    More...
    ExpressionAtlasi
    Q9C5C8 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    Q9C5C8 AT

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...
    BioGridi
    13563, 1 interactor

    Protein interaction database and analysis system

    More...
    IntActi
    Q9C5C8, 1 interactor

    STRING: functional protein association networks

    More...
    STRINGi
    3702.AT4G21860.1

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini77 – 198MsrBPROSITE-ProRule annotationAdd BLAST122

    <p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Keywords - Domaini

    Redox-active center, Transit peptide

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG0856 Eukaryota
    COG0229 LUCA

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...
    HOGENOMi
    HOG000243424

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    Q9C5C8

    KEGG Orthology (KO)

    More...
    KOi
    K07305

    Identification of Orthologs from Complete Genome Data

    More...
    OMAi
    ARTELKC

    Database of Orthologous Groups

    More...
    OrthoDBi
    1549489at2759

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    Q9C5C8

    Family and domain databases

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR028427 Met_Sox_Rdtase
    IPR002579 Met_Sox_Rdtase_MsrB
    IPR011057 Mss4-like_sf

    The PANTHER Classification System

    More...
    PANTHERi
    PTHR46081 PTHR46081, 1 hit

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF01641 SelR, 1 hit

    Superfamily database of structural and functional annotation

    More...
    SUPFAMi
    SSF51316 SSF51316, 1 hit

    TIGRFAMs; a protein family database

    More...
    TIGRFAMsi
    TIGR00357 TIGR00357, 1 hit

    PROSITE; a protein domain and family database

    More...
    PROSITEi
    View protein in PROSITE
    PS51790 MSRB, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
    Isoform 1 (identifier: Q9C5C8-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MAFNIITPGR VYSATSLTFV STIKAAFVKP PLASPSRRNL LRFSSSPLSF
    60 70 80 90 100
    PSLRRGFHGG RIVAMGSSAP ESVNKPEEEW RAILSPEQFR ILRQKGTEYP
    110 120 130 140 150
    GTGEYNKVFD DGIYCCAGCG TPLYKSTTKF DSGCGWPAFF DGLPGAITRT
    160 170 180 190 200
    PDPDGRRIEI TCAACGGHLG HVFKGEGFPT PTDERHCVNS ISLKFTPENP

    TL
    Length:202
    Mass (Da):21,968
    Last modified:June 1, 2001 - v1
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i53B85798B1E94D68
    GO
    Isoform 2 (identifier: Q9C5C8-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         151-184: PDPDGRRIEITCAACGGHLGHVFKGEGFPTPTDE → MGDESRSHVLLVEDILVTFLKEKVSLLLPMSDTV
         185-202: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:184
    Mass (Da):20,164
    Checksum:i1CFC2A20A3CAEF9A
    GO

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti31 – 37PLASPSR → SFASRSH in AAM62876 (Ref. 5) Curated7
    Sequence conflicti64A → S in AAM62876 (Ref. 5) Curated1
    Sequence conflicti79E → G in BAH19668 (PubMed:19423640).Curated1
    Sequence conflicti82A → T in AAM62876 (Ref. 5) Curated1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_039510151 – 184PDPDG…TPTDE → MGDESRSHVLLVEDILVTFL KEKVSLLLPMSDTV in isoform 2. 1 PublicationAdd BLAST34
    Alternative sequenceiVSP_039511185 – 202Missing in isoform 2. 1 PublicationAdd BLAST18

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    AL021890 Genomic DNA No translation available.
    AL161556 Genomic DNA No translation available.
    CP002687 Genomic DNA Translation: AEE84513.1
    CP002687 Genomic DNA Translation: AEE84514.1
    CP002687 Genomic DNA Translation: AEE84515.1
    CP002687 Genomic DNA Translation: ANM67853.1
    AF360341 mRNA Translation: AAK28638.1
    AY051078 mRNA Translation: AAK93755.1
    AK316971 mRNA Translation: BAH19668.1
    AY085655 mRNA Translation: AAM62876.1

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_001078423.1, NM_001084954.2 [Q9C5C8-2]
    NP_001190791.1, NM_001203862.1 [Q9C5C8-1]
    NP_001320026.1, NM_001341518.1 [Q9C5C8-1]
    NP_567639.1, NM_118306.7 [Q9C5C8-1]

    Genome annotation databases

    Ensembl plant genome annotation project

    More...
    EnsemblPlantsi
    AT4G21860.1; AT4G21860.1; AT4G21860 [Q9C5C8-1]
    AT4G21860.2; AT4G21860.2; AT4G21860 [Q9C5C8-2]
    AT4G21860.3; AT4G21860.3; AT4G21860 [Q9C5C8-1]
    AT4G21860.4; AT4G21860.4; AT4G21860 [Q9C5C8-1]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    828274

    Gramene; a comparative resource for plants

    More...
    Gramenei
    AT4G21860.1; AT4G21860.1; AT4G21860 [Q9C5C8-1]
    AT4G21860.2; AT4G21860.2; AT4G21860 [Q9C5C8-2]
    AT4G21860.3; AT4G21860.3; AT4G21860 [Q9C5C8-1]
    AT4G21860.4; AT4G21860.4; AT4G21860 [Q9C5C8-1]

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    ath:AT4G21860

    Keywords - Coding sequence diversityi

    Alternative splicing

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AL021890 Genomic DNA No translation available.
    AL161556 Genomic DNA No translation available.
    CP002687 Genomic DNA Translation: AEE84513.1
    CP002687 Genomic DNA Translation: AEE84514.1
    CP002687 Genomic DNA Translation: AEE84515.1
    CP002687 Genomic DNA Translation: ANM67853.1
    AF360341 mRNA Translation: AAK28638.1
    AY051078 mRNA Translation: AAK93755.1
    AK316971 mRNA Translation: BAH19668.1
    AY085655 mRNA Translation: AAM62876.1
    RefSeqiNP_001078423.1, NM_001084954.2 [Q9C5C8-2]
    NP_001190791.1, NM_001203862.1 [Q9C5C8-1]
    NP_001320026.1, NM_001341518.1 [Q9C5C8-1]
    NP_567639.1, NM_118306.7 [Q9C5C8-1]

    3D structure databases

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    SWISS-MODEL Interactive Workspace

    More...
    SWISS-MODEL-Workspacei
    Submit a new modelling project...

    Protein-protein interaction databases

    BioGridi13563, 1 interactor
    IntActiQ9C5C8, 1 interactor
    STRINGi3702.AT4G21860.1

    PTM databases

    iPTMnetiQ9C5C8

    Proteomic databases

    PaxDbiQ9C5C8
    PRIDEiQ9C5C8

    Genome annotation databases

    EnsemblPlantsiAT4G21860.1; AT4G21860.1; AT4G21860 [Q9C5C8-1]
    AT4G21860.2; AT4G21860.2; AT4G21860 [Q9C5C8-2]
    AT4G21860.3; AT4G21860.3; AT4G21860 [Q9C5C8-1]
    AT4G21860.4; AT4G21860.4; AT4G21860 [Q9C5C8-1]
    GeneIDi828274
    GrameneiAT4G21860.1; AT4G21860.1; AT4G21860 [Q9C5C8-1]
    AT4G21860.2; AT4G21860.2; AT4G21860 [Q9C5C8-2]
    AT4G21860.3; AT4G21860.3; AT4G21860 [Q9C5C8-1]
    AT4G21860.4; AT4G21860.4; AT4G21860 [Q9C5C8-1]
    KEGGiath:AT4G21860

    Organism-specific databases

    AraportiAT4G21860
    TAIRilocus:2141702 AT4G21860

    Phylogenomic databases

    eggNOGiKOG0856 Eukaryota
    COG0229 LUCA
    HOGENOMiHOG000243424
    InParanoidiQ9C5C8
    KOiK07305
    OMAiARTELKC
    OrthoDBi1549489at2759
    PhylomeDBiQ9C5C8

    Miscellaneous databases

    Protein Ontology

    More...
    PROi
    PR:Q9C5C8

    Gene expression databases

    ExpressionAtlasiQ9C5C8 baseline and differential
    GenevisibleiQ9C5C8 AT

    Family and domain databases

    InterProiView protein in InterPro
    IPR028427 Met_Sox_Rdtase
    IPR002579 Met_Sox_Rdtase_MsrB
    IPR011057 Mss4-like_sf
    PANTHERiPTHR46081 PTHR46081, 1 hit
    PfamiView protein in Pfam
    PF01641 SelR, 1 hit
    SUPFAMiSSF51316 SSF51316, 1 hit
    TIGRFAMsiTIGR00357 TIGR00357, 1 hit
    PROSITEiView protein in PROSITE
    PS51790 MSRB, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMSRB2_ARATH
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9C5C8
    Secondary accession number(s): A8MQE9, B9DG01, Q8LE28
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 13, 2010
    Last sequence update: June 1, 2001
    Last modified: October 16, 2019
    This is version 119 of the entry and version 1 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programPlant Protein Annotation Program

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families
    2. Arabidopsis thaliana
      Arabidopsis thaliana: entries and gene names
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again