Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 151 (08 May 2019)
Sequence version 2 (12 Feb 2003)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Rho GTPase-activating protein 39

Gene

ARHGAP39

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • GTPase activator activity Source: GO_Central

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-194840 Rho GTPase cycle
R-HSA-428543 Inactivation of CDC42 and RAC1

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q9C0H5

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Rho GTPase-activating protein 39
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ARHGAP39
Synonyms:KIAA1688
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29351 ARHGAP39

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
615880 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9C0H5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000147799

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA165585391

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ARHGAP39

Domain mapping of disease mutations (DMDM)

More...
DMDMi
28380079

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000760922 – 1083Rho GTPase-activating protein 39Add BLAST1082

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineCombined sources1
Modified residuei169PhosphoserineCombined sources1
Modified residuei286PhosphoserineCombined sources1
Modified residuei384PhosphoserineBy similarity1
Modified residuei388PhosphoserineCombined sources1
Modified residuei406PhosphoserineCombined sources1
Modified residuei407PhosphoserineCombined sources1
Modified residuei604PhosphoserineCombined sources1
Modified residuei690PhosphoserineCombined sources1
Modified residuei715PhosphoserineBy similarity1
Modified residuei726PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9C0H5

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9C0H5

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9C0H5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9C0H5

PeptideAtlas

More...
PeptideAtlasi
Q9C0H5

PRoteomics IDEntifications database

More...
PRIDEi
Q9C0H5

ProteomicsDB human proteome resource

More...
ProteomicsDBi
80042
80043 [Q9C0H5-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9C0H5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9C0H5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000147799 Expressed in 145 organ(s), highest expression level in oviduct epithelium

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9C0H5 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA044491

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123278, 20 interactors

Protein interaction database and analysis system

More...
IntActi
Q9C0H5, 14 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000366522

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9C0H5

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini25 – 58WW 1PROSITE-ProRule annotationAdd BLAST34
Domaini63 – 97WW 2PROSITE-ProRule annotationAdd BLAST35
Domaini722 – 879MyTH4PROSITE-ProRule annotationAdd BLAST158
Domaini890 – 1078Rho-GAPPROSITE-ProRule annotationAdd BLAST189

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi234 – 367Pro-richAdd BLAST134

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IG4K Eukaryota
ENOG410XQ23 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000003161

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000290162

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9C0H5

KEGG Orthology (KO)

More...
KOi
K20649

Identification of Orthologs from Complete Genome Data

More...
OMAi
DEVNCMK

Database of Orthologous Groups

More...
OrthoDBi
1123653at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9C0H5

TreeFam database of animal gene trees

More...
TreeFami
TF323577

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.555.10, 1 hit
1.25.40.530, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000857 MyTH4_dom
IPR038185 MyTH4_dom_sf
IPR008936 Rho_GTPase_activation_prot
IPR000198 RhoGAP_dom
IPR001202 WW_dom
IPR036020 WW_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00784 MyTH4, 1 hit
PF00620 RhoGAP, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00139 MyTH4, 1 hit
SM00324 RhoGAP, 1 hit
SM00456 WW, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48350 SSF48350, 1 hit
SSF51045 SSF51045, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51016 MYTH4, 1 hit
PS50238 RHOGAP, 1 hit
PS50020 WW_DOMAIN_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9C0H5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSQTQDYECR SHNVDLPESR IPGSNTRLEW VEIIEPRTRE RMYANLVTGE
60 70 80 90 100
CVWDPPAGVR IKRTSENQWW ELFDPNTSRF YYYNASTQRT VWHRPQGCDI
110 120 130 140 150
IPLAKLQTLK QNTESPRASA ESSPGRGSSV SREGSTSSSL EPEPDTEKAQ
160 170 180 190 200
ELPARAGRPA AFGTVKEDSG SSSPPGVFLE KDYEIYRDYS ADGQLLHYRT
210 220 230 240 250
SSLRWNSGAK ERMLIKVADR EPSFLAAQGN GYAPDGPPGV RSRRPSGSQH
260 270 280 290 300
SPSLQTFAPE ADGTIFFPER RPSPFLKRAE LPGSSSPLLA QPRKPSGDSQ
310 320 330 340 350
PSSPRYGYEP PLYEEPPVEY QAPIYDEPPM DVQFEAGGGY QAGSPQRSPG
360 370 380 390 400
RKPRPFLQPN KQGPPSPCQQ LVLTKQKCPE RFLSLEYSPA GKEYVRQLVY
410 420 430 440 450
VEQAGSSPKL RAGPRHKYAP NPGGGSYSLQ PSPCLLRDQR LGVKSGDYST
460 470 480 490 500
MEGPELRHSQ PPTPLPQAQE DAMSWSSQQD TLSSTGYSPG TRKRKSRKPS
510 520 530 540 550
LCQATSATPT EGPGDLLVEQ PLAEEQPPCG TSLAPVKRAE GEAEGARGAA
560 570 580 590 600
EPFLAQARLA WEAQQAHFHM KQRSSWDSQQ DGSGYESDGA LPLPMPGPVV
610 620 630 640 650
RAFSEDEALA QQENRHWRRG TFEKLGFPQI LLEKSVSVQT NLASPEPYLH
660 670 680 690 700
PSQSEDLAAC AQFESSRQSR SGVPSSSCVF PTFTLRKPSS ETDIENWASK
710 720 730 740 750
HFNKHTQGLF RRKVSIANML AWSSESIKKP MIVTSDRHVK KEACELFKLI
760 770 780 790 800
QMYMGDRRAK ADPLHVALEV ATKGWSVQGL RDELYIQLCR QTTENFRLES
810 820 830 840 850
LARGWELMAI CLAFFPPTPK FHSYLEGYIY RHMDPVNDTK GVAISTYAKY
860 870 880 890 900
CYHKLQKAAL TGAKKGLKKP NVEEIRHAKN AVFSPSMFGS ALQEVMGMQR
910 920 930 940 950
ERYPERQLPW VQTRLSEEVL ALNGDQTEGI FRVPGDIDEV NALKLQVDQW
960 970 980 990 1000
KVPTGLEDPH VPASLLKLWY RELEEPLIPH EFYEQCIAHY DSPEAAVAVV
1010 1020 1030 1040 1050
HALPRINRMV LCYLIRFLQV FVQPANVAVT KMDVSNLAMV MAPNCLRCQS
1060 1070 1080
DDPRVIFENT RKEMSFLRVL IQHLDTSFME GVL
Length:1,083
Mass (Da):121,286
Last modified:February 12, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i782B213B1DCB4072
GO
Isoform 2 (identifier: Q9C0H5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     840-840: K → KVTQHIKELLERNTKKKSKLRKKPKPYVEEPD

Show »
Length:1,114
Mass (Da):125,029
Checksum:iA232D306723FEAB6
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB21779 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAG64793 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_040749840K → KVTQHIKELLERNTKKKSKL RKKPKPYVEEPD in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB051475 mRNA Translation: BAB21779.1 Different initiation.
AC084125 Genomic DNA No translation available.
AK303851 mRNA Translation: BAG64793.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34971.1 [Q9C0H5-2]
CCDS78374.1 [Q9C0H5-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
C59434

NCBI Reference Sequences

More...
RefSeqi
NP_001295136.1, NM_001308207.1 [Q9C0H5-1]
NP_001295137.1, NM_001308208.1 [Q9C0H5-1]
NP_079527.1, NM_025251.2 [Q9C0H5-2]
XP_011515610.1, XM_011517308.1 [Q9C0H5-2]
XP_011515611.1, XM_011517309.1 [Q9C0H5-2]
XP_016869359.1, XM_017013870.1 [Q9C0H5-2]
XP_016869360.1, XM_017013871.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000276826; ENSP00000276826; ENSG00000147799 [Q9C0H5-1]
ENST00000377307; ENSP00000366522; ENSG00000147799 [Q9C0H5-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
80728

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:80728

UCSC genome browser

More...
UCSCi
uc064rpe.1 human [Q9C0H5-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB051475 mRNA Translation: BAB21779.1 Different initiation.
AC084125 Genomic DNA No translation available.
AK303851 mRNA Translation: BAG64793.1 Different initiation.
CCDSiCCDS34971.1 [Q9C0H5-2]
CCDS78374.1 [Q9C0H5-1]
PIRiC59434
RefSeqiNP_001295136.1, NM_001308207.1 [Q9C0H5-1]
NP_001295137.1, NM_001308208.1 [Q9C0H5-1]
NP_079527.1, NM_025251.2 [Q9C0H5-2]
XP_011515610.1, XM_011517308.1 [Q9C0H5-2]
XP_011515611.1, XM_011517309.1 [Q9C0H5-2]
XP_016869359.1, XM_017013870.1 [Q9C0H5-2]
XP_016869360.1, XM_017013871.1

3D structure databases

SMRiQ9C0H5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123278, 20 interactors
IntActiQ9C0H5, 14 interactors
STRINGi9606.ENSP00000366522

PTM databases

iPTMnetiQ9C0H5
PhosphoSitePlusiQ9C0H5

Polymorphism and mutation databases

BioMutaiARHGAP39
DMDMi28380079

Proteomic databases

EPDiQ9C0H5
jPOSTiQ9C0H5
MaxQBiQ9C0H5
PaxDbiQ9C0H5
PeptideAtlasiQ9C0H5
PRIDEiQ9C0H5
ProteomicsDBi80042
80043 [Q9C0H5-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000276826; ENSP00000276826; ENSG00000147799 [Q9C0H5-1]
ENST00000377307; ENSP00000366522; ENSG00000147799 [Q9C0H5-2]
GeneIDi80728
KEGGihsa:80728
UCSCiuc064rpe.1 human [Q9C0H5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
80728

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ARHGAP39

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0007862
HGNCiHGNC:29351 ARHGAP39
HPAiHPA044491
MIMi615880 gene
neXtProtiNX_Q9C0H5
OpenTargetsiENSG00000147799
PharmGKBiPA165585391

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IG4K Eukaryota
ENOG410XQ23 LUCA
GeneTreeiENSGT00390000003161
HOGENOMiHOG000290162
InParanoidiQ9C0H5
KOiK20649
OMAiDEVNCMK
OrthoDBi1123653at2759
PhylomeDBiQ9C0H5
TreeFamiTF323577

Enzyme and pathway databases

ReactomeiR-HSA-194840 Rho GTPase cycle
R-HSA-428543 Inactivation of CDC42 and RAC1
SignaLinkiQ9C0H5

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
80728

Protein Ontology

More...
PROi
PR:Q9C0H5

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000147799 Expressed in 145 organ(s), highest expression level in oviduct epithelium
GenevisibleiQ9C0H5 HS

Family and domain databases

Gene3Di1.10.555.10, 1 hit
1.25.40.530, 1 hit
InterProiView protein in InterPro
IPR000857 MyTH4_dom
IPR038185 MyTH4_dom_sf
IPR008936 Rho_GTPase_activation_prot
IPR000198 RhoGAP_dom
IPR001202 WW_dom
IPR036020 WW_dom_sf
PfamiView protein in Pfam
PF00784 MyTH4, 1 hit
PF00620 RhoGAP, 1 hit
SMARTiView protein in SMART
SM00139 MyTH4, 1 hit
SM00324 RhoGAP, 1 hit
SM00456 WW, 2 hits
SUPFAMiSSF48350 SSF48350, 1 hit
SSF51045 SSF51045, 1 hit
PROSITEiView protein in PROSITE
PS51016 MYTH4, 1 hit
PS50238 RHOGAP, 1 hit
PS50020 WW_DOMAIN_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRHG39_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9C0H5
Secondary accession number(s): B4E1I1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 12, 2003
Last sequence update: February 12, 2003
Last modified: May 8, 2019
This is version 151 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again