Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 144 (29 Sep 2021)
Sequence version 3 (05 Feb 2008)
Previous versions | rss
Add a publicationFeedback
Protein

Dynein axonemal heavy chain 6

Gene

DNAH6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP (By similarity).

By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi192 – 199ATPSequence analysis8
Nucleotide bindingi1472 – 1479ATPSequence analysis8
Nucleotide bindingi1753 – 1760ATPSequence analysis8
Nucleotide bindingi2096 – 2103ATPSequence analysis8
Nucleotide bindingi2447 – 2454ATPSequence analysis8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMotor protein
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9C0G6

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Dynein axonemal heavy chain 6Curated
Alternative name(s):
Axonemal beta dynein heavy chain 6
Ciliary dynein heavy chain 6
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DNAH6Imported
Synonyms:DNAHC6, DNHL1, HL2, KIAA1697
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:2951, DNAH6

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603336, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9C0G6

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000115423

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Dynein, Microtubule

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
1768

Open Targets

More...
OpenTargetsi
ENSG00000115423

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27404

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9C0G6, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DNAH6

Domain mapping of disease mutations (DMDM)

More...
DMDMi
166922150

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003176651 – 4158Dynein axonemal heavy chain 6Add BLAST4158

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9C0G6

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9C0G6

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9C0G6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9C0G6

PeptideAtlas

More...
PeptideAtlasi
Q9C0G6

PRoteomics IDEntifications database

More...
PRIDEi
Q9C0G6

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
80034 [Q9C0G6-1]
80035 [Q9C0G6-2]
80036 [Q9C0G6-3]
80037 [Q9C0G6-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9C0G6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9C0G6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in several tissues, including brain, pituitary, testis and trachea, with highest levels in testis.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000115423, Expressed in epithelium of bronchus and 132 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9C0G6, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000115423, Tissue enhanced (brain, fallopian tube, pituitary gland)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

The dynein complex consists of at least two heavy chains and a number of intermediate and light chains.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
108107, 7 interactors

Protein interaction database and analysis system

More...
IntActi
Q9C0G6, 4 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000374045

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9C0G6, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9C0G6

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 1433StemBy similarityAdd BLAST1433
Regioni1434 – 1655AAA 1By similarityAdd BLAST222
Regioni1715 – 1948AAA 2By similarityAdd BLAST234
Regioni2058 – 2306AAA 3By similarityAdd BLAST249
Regioni2408 – 2659AAA 4By similarityAdd BLAST252
Regioni2676 – 2961StalkBy similarityAdd BLAST286
Regioni3042 – 3272AAA 5By similarityAdd BLAST231
Regioni3509 – 3730AAA 6By similarityAdd BLAST222

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili805 – 859Sequence analysisAdd BLAST55
Coiled coili2901 – 2996Sequence analysisAdd BLAST96

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Dynein heavy chains probably consist of an N-terminal stem (which binds cargo and interacts with other dynein components), and the head or motor domain. The motor contains six tandemly-linked AAA domains in the head, which form a ring. A stalk-like structure (formed by two of the coiled coil domains) protrudes between AAA 4 and AAA 5 and terminates in a microtubule-binding site. A seventh domain may also contribute to this ring; it is not clear whether the N-terminus or the C-terminus forms this extra domain. There are four well-conserved and two non-conserved ATPase sites, one per AAA domain. Probably only one of these (within AAA 1) actually hydrolyzes ATP, the others may serve a regulatory function (By similarity).By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the dynein heavy chain family.Curated

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3595, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154761

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_000038_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9C0G6

Identification of Orthologs from Complete Genome Data

More...
OMAi
VESFDWQ

Database of Orthologous Groups

More...
OrthoDBi
1492at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9C0G6

TreeFam database of animal gene trees

More...
TreeFami
TF352520

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.8.710, 1 hit
1.10.8.720, 1 hit
1.20.140.100, 1 hit
3.10.490.20, 1 hit
3.20.180.20, 1 hit
3.40.50.300, 5 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003593, AAA+_ATPase
IPR035699, AAA_6
IPR035706, AAA_9
IPR041658, AAA_lid_11
IPR042219, AAA_lid_11_sf
IPR041589, DNAH3_AAA_lid_1
IPR026980, DNAH6/14
IPR042222, Dynein_2_N
IPR043157, Dynein_AAA1S
IPR041466, Dynein_AAA5_ext
IPR041228, Dynein_C
IPR043160, Dynein_C_barrel
IPR024743, Dynein_HC_stalk
IPR024317, Dynein_heavy_chain_D4_dom
IPR004273, Dynein_heavy_D6_P-loop
IPR013602, Dynein_heavy_linker
IPR042228, Dynein_linker_3
IPR027417, P-loop_NTPase

The PANTHER Classification System

More...
PANTHERi
PTHR46454:SF6, PTHR46454:SF6, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12774, AAA_6, 1 hit
PF12780, AAA_8, 1 hit
PF12781, AAA_9, 1 hit
PF17857, AAA_lid_1, 1 hit
PF18198, AAA_lid_11, 1 hit
PF08393, DHC_N2, 1 hit
PF17852, Dynein_AAA_lid, 1 hit
PF18199, Dynein_C, 1 hit
PF03028, Dynein_heavy, 1 hit
PF12777, MT, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00382, AAA, 4 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540, SSF52540, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9C0G6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTFRATDSEF DLTNIEEYAE NSALSRLNNI KAKQRVSYVT STENESDTQI
60 70 80 90 100
LTFRHITKAQ EKTRKRQQPI KLEPLPVLKV YQDHKQPEYI HEQNRFQLMT
110 120 130 140 150
AGIIKRPVSI AKKSFATSST QFLEHQDAVK KMQIHRPYVE VFSPSPPKLP
160 170 180 190 200
HTGIGKRGLF GTRSSAYPKY TFHDREEVVK ANIRDPLQII KIIRENEHLG
210 220 230 240 250
FLYMIPAVPR SSIEYDTYNL KVVSYENINK NDYYTISQRA VTHIYNEDIE
260 270 280 290 300
FIEIDRWEQE YLYHRELTKI PIFSLFRKWK AFSVWRKNVR SKKITGCQKS
310 320 330 340 350
LQKNLFIVNP HLRPALLKIN ELCYHLSFMG LCYIEKCHTY TLQEFKAAQV
360 370 380 390 400
IRLAEVTERL GEFRNEAKYV VRRACRFALR AAGFVPDDCA FGPFEDYHKV
410 420 430 440 450
QSSGSFINTP HELPTYGDSE KMTYTEQASK RHYCMRLTCF IRLNDYLIEN
460 470 480 490 500
TMHILTVNAV NSLLNHLTDK LKRTPSADVI QKWITEEKPE VPDKKGTLMV
510 520 530 540 550
EKQEEDESLI PMFLTELMLT VQSLLFEPSL EDFLDGILGA VNHCQNTVLS
560 570 580 590 600
VPNLVPDSYF DAFTSPYINN KLEGKTCGTG PSLAAVFEDD KNFHTIISQI
610 620 630 640 650
KETIQAAFES ARIYAATFEK FQIFFKENES LDLQALKLQE PDINFFSEQL
660 670 680 690 700
EKYHKQHKDA VALRPTRNVG LLLIDTRLLR EKLIPSPLRC LEVLNFMLPR
710 720 730 740 750
QSKKKVDAII FEAQDAEYKL EFVPTTTTEY VHSLLFLDEI QERIESLEDE
760 770 780 790 800
GNIVTQMYKL MEQYQVPTPP EDFAVFATMK PSIVAVRNAI DKSVGDRESS
810 820 830 840 850
IKQFCVHLGS DLEELNNEVN EVKLQAQDPQ ILDISADQDK IRLILNNLQS
860 870 880 890 900
VLADLQKRAF QYKSYQKNFK VEVSKFEALE EVSAELKLKQ LLWDSFSEWD
910 920 930 940 950
KLQQEWLKSK FDCLDPEVLN GQVSKYAKFV TQLEKGLPPN SVVPQLKYKV
960 970 980 990 1000
EKMKEKLPVI IDLRNPTLKA RHWAAIEQTV DATLVDAEIP LTLERLSQLH
1010 1020 1030 1040 1050
VFDFGQEIQD ISGQASGEAA LEAILKKVED SWKTTEFVIL PHRDSKDVFI
1060 1070 1080 1090 1100
LGGTDDIQVL LDDSTINVAT LASSRYLGPL KTRVDEWQKQ LALFNQTLEE
1110 1120 1130 1140 1150
WLTCQRNWLY LESIFNAPDI QRQLPAEAKM FLQVDKSWKE IMRKVNRLPN
1160 1170 1180 1190 1200
ALRAATQPGL LETFQNNNAL LDQIQKCLEA YLESKRVIFP RFYFLSNDEL
1210 1220 1230 1240 1250
LEILAQTRNP QAVQPHLRKC FDSISKLEFA LMPPAEGKIP GIDGEPEKVY
1260 1270 1280 1290 1300
TNDILAMLSP EGERVSLGKG LKARGNVEEW LGKVEEAMFT SLRRLCKAAI
1310 1320 1330 1340 1350
ADYQGKLRTD WVVAGHPSQV ILTVSQIMWC RDLTECLETE HSNHIQALKN
1360 1370 1380 1390 1400
FEKVNFERLN ALAAIVQGSL PKLHRNILTA LITIDVHARD IVTELVQSKV
1410 1420 1430 1440 1450
ETVESFDWQR QLRYYWDIDL DNCVARMALS QYTYGYEYLG ACPRLVITPL
1460 1470 1480 1490 1500
TDRCYLCLMG ALQLDLGGAP AGPAGTGKTE TTKDLAKALA IQCVVFNCSD
1510 1520 1530 1540 1550
GLDYKMMGRF FSGLAQSGAW CCFDEFNRID IEVLSVIAQQ LITIRNAKAA
1560 1570 1580 1590 1600
KLSRFMFEGR EIKLVMTCAA FITMNPGYAG RTELPDNLKA LFRPFAMMVP
1610 1620 1630 1640 1650
NYALIAEVIL YSEGFESSKI LARKMTQMYK LCSEQLSQQD HYDFGMRAVK
1660 1670 1680 1690 1700
SVLVMAGSLK RENPDLNEDV VLIRALQDSN LPKFLTDDAL LFSGIISDLF
1710 1720 1730 1740 1750
PGVQIPEHDY GILQSTIVDV MNRQNLQPEM CMVRKVIQFY ETMLVRHGVM
1760 1770 1780 1790 1800
LVGPTGGGKT TVYRILAETL GNLQKLGIEN SFYQAVKTYV LNPKSITMGE
1810 1820 1830 1840 1850
LYGEVNNLTL EWKDGLMALS VRAAVNDTSE DHKWIISDGP VDALWIENMN
1860 1870 1880 1890 1900
TVLDDNKMLC LANSERIKLT PQIHMLFEVQ DLRVASPATV SRCGMVFVDP
1910 1920 1930 1940 1950
EELKWMPYVK TWMKGISKKL TEETQEYILN LFQRYVDEGL HFINKKCSQA
1960 1970 1980 1990 2000
IPQVDISKVT TLCCLLESLI LGKDGVNLAM EQTKLNTILC QTFVFCYLWS
2010 2020 2030 2040 2050
LGGNLTENYY DSFDTFIRTQ FDDNPDARLP NSGDLWSIHM DFDTKRLDPW
2060 2070 2080 2090 2100
ERIIPTFKYN RDVPFFEMLV PTTDTVRYGY LMEKLLAVKH SVLFTGITGV
2110 2120 2130 2140 2150
GKSVIAKGLL NKIQESAGYV PVYLNFSAQT SSARTQEIIE SKLERKRKNI
2160 2170 2180 2190 2200
LGAPGNKRIV IFVDDLNMPR LDRYGSQPPI ELLRQYQDFG GFYDRNKLFW
2210 2220 2230 2240 2250
KEIQDVTIIS ACAPPGGGRN PVTPRFIRHF SMLCLPMPSE HSLKQIFQAI
2260 2270 2280 2290 2300
LNGFLSDFPP AVKQTASSIV EASVEIYNKM SVDLLPTPAK SHYVFNLRDL
2310 2320 2330 2340 2350
SKCVQGILQC DPGTIREEIQ IFRLFCHECQ RVFHDRLINN EDKHYFHVIL
2360 2370 2380 2390 2400
TEMANKHFGI AIDLEYFLNK PIIFGDFIKF GADKADRIYD DMPDIEKTAN
2410 2420 2430 2440 2450
VLQDYLDDYN LTNPKEVKLV FFQDAIEHVS RIARMIRQER GNALLVGVGG
2460 2470 2480 2490 2500
TGKQSLTRLA AHICGYKCLQ IELSRGYNYD SFHEDLRKLY KMAGVEDKNM
2510 2520 2530 2540 2550
VFLFTDTQIV VEEFLEDINN ILNSGEVPNL FEKDELEQVL AATRPRAKEV
2560 2570 2580 2590 2600
GISEGNRDEV FQYFISKVRQ KLHIVLCMSP VGEAFRSRCR MFPSLVNCCT
2610 2620 2630 2640 2650
IDWFVQWPRE ALLSVSKTFF SQVDAGNEEL KEKLPLMCVN VHLSVSSMAE
2660 2670 2680 2690 2700
RYYNELRRRY YTTPTSYLEL INLYLSMLSE KRKQIISARD RVKNGLTKLL
2710 2720 2730 2740 2750
ETNILVDKMK LDLSALEPVL LAKSEDVEAL MEKLAVDQES ADQVRNTVQE
2760 2770 2780 2790 2800
DEATAKVKAE ETQAIADDAQ RDLDEALPAL DAANKALDSL DKADISEIRV
2810 2820 2830 2840 2850
FTKPPDLVMT VMEAISILLN AKPDWPSAKQ LLGDSNFLKR LLEYDKENIK
2860 2870 2880 2890 2900
PQILAKLQKY INNPDFVPEK VEKVSKACKS MCMWVRAMDL YSRVVKVVEP
2910 2920 2930 2940 2950
KRQKLRAAQA ELDITMATLR EKQALLRQVE DQIQALQDEY DKGVNEKESL
2960 2970 2980 2990 3000
AKTMALTKAR LVRAGKLTAA LEDEQVRWEE SIQKFEEEIS NITGNVFIAA
3010 3020 3030 3040 3050
ACVAYYGAFT AQYRQSLIEC WIQDCQSLEI PIDPSFSLIN ILGDPYEIRQ
3060 3070 3080 3090 3100
WNTDGLPRDL ISTENGILVT QGRRWPLMID PQDQANRWIR NKESKSGLKI
3110 3120 3130 3140 3150
IKLTDSNFLR ILENSIRLGL PVLLEELKET LDPALEPILL KQIFISGGRL
3160 3170 3180 3190 3200
LIRLGDSDID YDKNFRFYMT TKMPNPHYLP EVCIKVTIIN FTVTKSGLED
3210 3220 3230 3240 3250
QLLSDVVRLE KPRLEEQRIK LIVRINTDKN QLKTIEEKIL RMLFTSEGNI
3260 3270 3280 3290 3300
LDNEELIDTL QDSKITSGAI KTRLEEAEST EQMINVAREK YRPVATQGSV
3310 3320 3330 3340 3350
MYFVIASLSE IDPMYQYSLK YFKQLFNTTI ETSVKTENLQ QRLDVLLEQT
3360 3370 3380 3390 3400
LLTAYVNVSR GLFEQHKLIY SFMLCVEMMR QQGTLSDAEW NFFLRGSAGL
3410 3420 3430 3440 3450
EKERPPKPEA PWLPTATWFA CCDLEESFPV FHGLTQNILS HPISIRLGSF
3460 3470 3480 3490 3500
ETYINPQKWE GYSKMKHEDK HMRQEKEAAH QDPWSAGLSS FHKLILIKCC
3510 3520 3530 3540 3550
KEEKVVFALT DFVIENLGKQ FIETPPVDLP TLYQDMSCNT PLVFILSTGS
3560 3570 3580 3590 3600
DPMGAFQRFA RESGYSERVQ SISLGQGQGP IAEKMVKDAM KSGNWVFLQN
3610 3620 3630 3640 3650
CHLAVSWMLA MEELIKTFTD PDSAIKDTFR LFLSSMPSNT FPVTVLQNSV
3660 3670 3680 3690 3700
KVTNEPPKGL RANIRRAFTE MTPSFFEENI LGKKWRQIIF GICFFHAIIQ
3710 3720 3730 3740 3750
ERKKFGPLGW NICYEFNDSD RECALLNLKL YCKEGKIPWD ALIYITGEIT
3760 3770 3780 3790 3800
YGGRVTDSWD QRCLRTILKR FFSPETLEED YKYSESGIYF APMADSLQEF
3810 3820 3830 3840 3850
KDYIENLPLI DDPEIFGMHE NANLVFQYKE TSTLINTILE VQPRSSTGGE
3860 3870 3880 3890 3900
GKSNDEIVQE LVASVQTRVP EKLEMEGASE SLFVKDLQGR LNSLTTVLGQ
3910 3920 3930 3940 3950
EVDRFNNLLK LIHTSLETLN KAIAGFVVMS EEMEKVYNSF LNNQVPALWS
3960 3970 3980 3990 4000
NTAYPSLKPL GSWVKDLILR TSFVDLWLKR GQPKSYWISG FFFPQGFLTG
4010 4020 4030 4040 4050
TLQNHARKYN LPIDELSFKY SVIPTYRDQA AVIEAAKTVQ FGQELPMDME
4060 4070 4080 4090 4100
LPSPEDGVLV HGMFMDASRW DDKEMVIEDA LPGQMNPVLP VVHFEPQQNY
4110 4120 4130 4140 4150
KPSPTLYHCP LYKTGARAGT LSTTGHSTNF VVTVLLPSKR SKDYWIAKGS

ALLCQLSE
Length:4,158
Mass (Da):475,983
Last modified:February 5, 2008 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8ADAA07BC375F683
GO
Isoform 2 (identifier: Q9C0G6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-3241: Missing.
     3828-3833: YKETST → VCGLSS
     3834-4158: Missing.

Show »
Length:592
Mass (Da):67,987
Checksum:iA85D06CA292775D5
GO
Isoform 3 (identifier: Q9C0G6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-421: Missing.
     828-829: DP → VS
     830-4158: Missing.

Show »
Length:408
Mass (Da):46,770
Checksum:iFF235AE32DA3422E
GO
Isoform 4 (identifier: Q9C0G6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2306-2355: GILQCDPGTIREEIQIFRLFCHECQRVFHDRLINNEDKHYFHVILTEMAN → D
     2561-2579: FQYFISKVRQKLHIVLCMS → GCARVVMWLYHKNVSSPFI
     2580-4158: Missing.

Show »
Length:2,530
Mass (Da):289,572
Checksum:i455378AD5AC8DD99
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH15442 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAX93115 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence BAB15685 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1504Y → C in CAA10559 (PubMed:11175280).Curated1
Sequence conflicti1521C → G in AAC50700 (PubMed:8812413).Curated1
Sequence conflicti3716F → S in BAB15685 (PubMed:14702039).Curated1
Sequence conflicti3965K → R in BAB15685 (PubMed:14702039).Curated1
Sequence conflicti4151A → V in BAB15685 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0800353471H → Q Found in a patient with azoospermia; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs61731722Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0311221 – 3241Missing in isoform 2. 1 PublicationAdd BLAST3241
Alternative sequenceiVSP_0311231 – 421Missing in isoform 3. 2 PublicationsAdd BLAST421
Alternative sequenceiVSP_031124828 – 829DP → VS in isoform 3. 2 Publications2
Alternative sequenceiVSP_031125830 – 4158Missing in isoform 3. 2 PublicationsAdd BLAST3329
Alternative sequenceiVSP_0311262306 – 2355GILQC…TEMAN → D in isoform 4. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_0311272561 – 2579FQYFI…VLCMS → GCARVVMWLYHKNVSSPFI in isoform 4. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_0311282580 – 4158Missing in isoform 4. 1 PublicationAdd BLAST1579
Alternative sequenceiVSP_0311293828 – 3833YKETST → VCGLSS in isoform 2. 1 Publication6
Alternative sequenceiVSP_0311303834 – 4158Missing in isoform 2. 1 PublicationAdd BLAST325

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK027182 mRNA Translation: BAB15685.1 Frameshift.
AK094676 mRNA Translation: BAC04400.1
AL512706 mRNA Translation: CAC21651.1
AC010087 Genomic DNA Translation: AAX93108.1
AC096770 Genomic DNA Translation: AAY24108.1
AC098975 Genomic DNA Translation: AAX93115.1 Sequence problems.
AC109827 Genomic DNA No translation available.
CH471053 Genomic DNA Translation: EAW99557.1
BC015442 mRNA Translation: AAH15442.1 Different initiation.
BC104884 mRNA Translation: AAI04885.1
BC113424 mRNA Translation: AAI13425.1
BC117259 mRNA Translation: AAI17260.1
BC143666 mRNA Translation: AAI43667.1
U61736 mRNA Translation: AAC50700.1
AJ132086 mRNA Translation: CAA10559.1
AB051484 mRNA Translation: BAB21788.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS46348.1 [Q9C0G6-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001361.1, NM_001370.1 [Q9C0G6-1]
XP_006712019.1, XM_006711956.2 [Q9C0G6-1]
XP_011530951.1, XM_011532649.2 [Q9C0G6-1]
XP_011530952.1, XM_011532650.2 [Q9C0G6-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000389394; ENSP00000374045; ENSG00000115423 [Q9C0G6-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
1768

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:1768

UCSC genome browser

More...
UCSCi
uc002sor.4, human [Q9C0G6-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK027182 mRNA Translation: BAB15685.1 Frameshift.
AK094676 mRNA Translation: BAC04400.1
AL512706 mRNA Translation: CAC21651.1
AC010087 Genomic DNA Translation: AAX93108.1
AC096770 Genomic DNA Translation: AAY24108.1
AC098975 Genomic DNA Translation: AAX93115.1 Sequence problems.
AC109827 Genomic DNA No translation available.
CH471053 Genomic DNA Translation: EAW99557.1
BC015442 mRNA Translation: AAH15442.1 Different initiation.
BC104884 mRNA Translation: AAI04885.1
BC113424 mRNA Translation: AAI13425.1
BC117259 mRNA Translation: AAI17260.1
BC143666 mRNA Translation: AAI43667.1
U61736 mRNA Translation: AAC50700.1
AJ132086 mRNA Translation: CAA10559.1
AB051484 mRNA Translation: BAB21788.2
CCDSiCCDS46348.1 [Q9C0G6-1]
RefSeqiNP_001361.1, NM_001370.1 [Q9C0G6-1]
XP_006712019.1, XM_006711956.2 [Q9C0G6-1]
XP_011530951.1, XM_011532649.2 [Q9C0G6-1]
XP_011530952.1, XM_011532650.2 [Q9C0G6-1]

3D structure databases

SMRiQ9C0G6
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi108107, 7 interactors
IntActiQ9C0G6, 4 interactors
STRINGi9606.ENSP00000374045

PTM databases

iPTMnetiQ9C0G6
PhosphoSitePlusiQ9C0G6

Genetic variation databases

BioMutaiDNAH6
DMDMi166922150

Proteomic databases

EPDiQ9C0G6
jPOSTiQ9C0G6
MassIVEiQ9C0G6
PaxDbiQ9C0G6
PeptideAtlasiQ9C0G6
PRIDEiQ9C0G6
ProteomicsDBi80034 [Q9C0G6-1]
80035 [Q9C0G6-2]
80036 [Q9C0G6-3]
80037 [Q9C0G6-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
31722, 50 antibodies

The DNASU plasmid repository

More...
DNASUi
1768

Genome annotation databases

EnsembliENST00000389394; ENSP00000374045; ENSG00000115423 [Q9C0G6-1]
GeneIDi1768
KEGGihsa:1768
UCSCiuc002sor.4, human [Q9C0G6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1768
DisGeNETi1768

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DNAH6
HGNCiHGNC:2951, DNAH6
HPAiENSG00000115423, Tissue enhanced (brain, fallopian tube, pituitary gland)
MIMi603336, gene
neXtProtiNX_Q9C0G6
OpenTargetsiENSG00000115423
PharmGKBiPA27404
VEuPathDBiHostDB:ENSG00000115423

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3595, Eukaryota
GeneTreeiENSGT00940000154761
HOGENOMiCLU_000038_0_0_1
InParanoidiQ9C0G6
OMAiVESFDWQ
OrthoDBi1492at2759
PhylomeDBiQ9C0G6
TreeFamiTF352520

Enzyme and pathway databases

PathwayCommonsiQ9C0G6

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
1768, 4 hits in 1011 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DNAH6, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
1768
PharosiQ9C0G6, Tdark

Protein Ontology

More...
PROi
PR:Q9C0G6
RNActiQ9C0G6, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000115423, Expressed in epithelium of bronchus and 132 other tissues
GenevisibleiQ9C0G6, HS

Family and domain databases

Gene3Di1.10.8.710, 1 hit
1.10.8.720, 1 hit
1.20.140.100, 1 hit
3.10.490.20, 1 hit
3.20.180.20, 1 hit
3.40.50.300, 5 hits
InterProiView protein in InterPro
IPR003593, AAA+_ATPase
IPR035699, AAA_6
IPR035706, AAA_9
IPR041658, AAA_lid_11
IPR042219, AAA_lid_11_sf
IPR041589, DNAH3_AAA_lid_1
IPR026980, DNAH6/14
IPR042222, Dynein_2_N
IPR043157, Dynein_AAA1S
IPR041466, Dynein_AAA5_ext
IPR041228, Dynein_C
IPR043160, Dynein_C_barrel
IPR024743, Dynein_HC_stalk
IPR024317, Dynein_heavy_chain_D4_dom
IPR004273, Dynein_heavy_D6_P-loop
IPR013602, Dynein_heavy_linker
IPR042228, Dynein_linker_3
IPR027417, P-loop_NTPase
PANTHERiPTHR46454:SF6, PTHR46454:SF6, 1 hit
PfamiView protein in Pfam
PF12774, AAA_6, 1 hit
PF12780, AAA_8, 1 hit
PF12781, AAA_9, 1 hit
PF17857, AAA_lid_1, 1 hit
PF18198, AAA_lid_11, 1 hit
PF08393, DHC_N2, 1 hit
PF17852, Dynein_AAA_lid, 1 hit
PF18199, Dynein_C, 1 hit
PF03028, Dynein_heavy, 1 hit
PF12777, MT, 1 hit
SMARTiView protein in SMART
SM00382, AAA, 4 hits
SUPFAMiSSF52540, SSF52540, 4 hits

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDYH6_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9C0G6
Secondary accession number(s): A0PJN9
, B5MEE0, B7ZL99, O95493, Q53QZ1, Q53TE5, Q8N1W6, Q92861, Q96BL6, Q9H030, Q9H5E1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: February 5, 2008
Last modified: September 29, 2021
This is version 144 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again