Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 145 (11 Dec 2019)
Sequence version 2 (23 Oct 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Zinc finger protein 407

Gene

ZNF407

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri186 – 208C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri215 – 238C2H2-type 2PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri244 – 268C2H2-type 3PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri528 – 551C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri557 – 581C2H2-type 5PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri615 – 639C2H2-type 6PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri705 – 728C2H2-type 7PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri850 – 873C2H2-type 8PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri879 – 903C2H2-type 9PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri1017 – 1040C2H2-type 10PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1046 – 1070C2H2-type 11PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri1444 – 1468C2H2-type 12PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri1486 – 1509C2H2-type 13PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1537 – 1561C2H2-type 14; degeneratePROSITE-ProRule annotationAdd BLAST25
Zinc fingeri1567 – 1589C2H2-type 15PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1595 – 1618C2H2-type 16PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1628 – 1650C2H2-type 17PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1656 – 1680C2H2-type 18PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri1686 – 1708C2H2-type 19PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1714 – 1736C2H2-type 20PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1742 – 1767C2H2-type 21PROSITE-ProRule annotationAdd BLAST26
Zinc fingeri1773 – 1796C2H2-type 22PROSITE-ProRule annotationAdd BLAST24

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger protein 407
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZNF407
Synonyms:KIAA1703
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 18

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000215421.9

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19904 ZNF407

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
615894 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9C0G0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
55628

Open Targets

More...
OpenTargetsi
ENSG00000215421

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134942906

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9C0G0 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZNF407

Domain mapping of disease mutations (DMDM)

More...
DMDMi
160358927

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000475681 – 2248Zinc finger protein 407Add BLAST2248

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1262PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9C0G0

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9C0G0

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9C0G0

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9C0G0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9C0G0

PeptideAtlas

More...
PeptideAtlasi
Q9C0G0

PRoteomics IDEntifications database

More...
PRIDEi
Q9C0G0

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
80031 [Q9C0G0-1]
80032 [Q9C0G0-2]
80033 [Q9C0G0-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9C0G0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9C0G0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000215421 Expressed in 198 organ(s), highest expression level in secondary oocyte

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9C0G0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9C0G0 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA028255
HPA041673

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120767, 7 interactors

Protein interaction database and analysis system

More...
IntActi
Q9C0G0, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000299687

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9C0G0 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9C0G0

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri186 – 208C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri215 – 238C2H2-type 2PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri244 – 268C2H2-type 3PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri528 – 551C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri557 – 581C2H2-type 5PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri615 – 639C2H2-type 6PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri705 – 728C2H2-type 7PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri850 – 873C2H2-type 8PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri879 – 903C2H2-type 9PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri1017 – 1040C2H2-type 10PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1046 – 1070C2H2-type 11PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri1444 – 1468C2H2-type 12PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri1486 – 1509C2H2-type 13PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1537 – 1561C2H2-type 14; degeneratePROSITE-ProRule annotationAdd BLAST25
Zinc fingeri1567 – 1589C2H2-type 15PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1595 – 1618C2H2-type 16PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1628 – 1650C2H2-type 17PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1656 – 1680C2H2-type 18PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri1686 – 1708C2H2-type 19PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1714 – 1736C2H2-type 20PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1742 – 1767C2H2-type 21PROSITE-ProRule annotationAdd BLAST26
Zinc fingeri1773 – 1796C2H2-type 22PROSITE-ProRule annotationAdd BLAST24

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1721 Eukaryota
COG5048 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156446

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000155792

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9C0G0

Database of Orthologous Groups

More...
OrthoDBi
1318335at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9C0G0

TreeFam database of animal gene trees

More...
TreeFami
TF350895

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003604 Matrin/U1-like-C_Znf_C2H2
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00096 zf-C2H2, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00355 ZnF_C2H2, 25 hits
SM00451 ZnF_U1, 7 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57667 SSF57667, 5 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 8 hits
PS50157 ZINC_FINGER_C2H2_2, 9 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9C0G0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMDSENKPEN DEDEKINKEA QDLTKLSSHN EDGGPVSDVI ASFPENSMGK
60 70 80 90 100
RGFSESSNSD SVVIGEDRNK HASKRRKLDE AEPLKSGKQG ICRLETSESS
110 120 130 140 150
VTEGGIALDE TGKETFLSDC TVGGTCLPNA LSPSCNFSTI DVVSLKTDTE
160 170 180 190 200
KTSAQEMVSL DLERESPFPP KEISVSCTIG NVDTVLKCSI CGHLFSSCSD
210 220 230 240 250
LEKHAESHMQ QPKEHTCCHC SHKAESSSAL HMHIKQAHGP QKVFSCDLCG
260 270 280 290 300
FQCSEENLLN AHYLGKTHLR RQNLAARGGF VQILTKQPFP KKSRTMATKN
310 320 330 340 350
VHSKPRTSKS IAKNSDSKGL RNVGSTFKDF RGSISKQSGS SSELLVEMMP
360 370 380 390 400
SRNTLSQEVE IVEEHVTSLG LAQNPENQSR KLDTLVTSEG LLEKLESTKN
410 420 430 440 450
TLQAAHGNSV TSRPRPERNI LVLGNSFRRR SSTFTLKGQA KKRFNLLGIK
460 470 480 490 500
RGTSETQRMY MKHLRTQMKT HDAESVLKHL EACSSVQRVC VTTSETQEAE
510 520 530 540 550
QGQGSARPPD SGLHSLTVKP ASGSQTLCAC TDCGQVATNR TDLEIHVKRC
560 570 580 590 600
HAREMKFYCR TCDFSSMSRR DLDEHLHSNQ HQQTASVLSC QCCSFISLDE
610 620 630 640 650
INLRDHMKEK HNMHFLCTPC NLFFLSEKDV EEHKATEKHI NSLVQPKTLQ
660 670 680 690 700
SSNSDLVLQT LPLSTLESEN AKESMDDSGK ASQEEPLKSR VSHGNEVRHS
710 720 730 740 750
SKPQFQCKKC FYKTRSSTVL TRHIKLRHGQ DYHFLCKACN LYSLSKEGME
760 770 780 790 800
KHIKRSKHLE NAKKNNIGLS FEECIERVCI GANDKKEEFD VSGNGRIEGH
810 820 830 840 850
IGVQLQEHSY LEKGMLASEE LSQSGGSTKD DELASTTTPK RGRPKGNISR
860 870 880 890 900
TCSHCGLLAS SITNLTVHIR RKHSHQYSYL CKVCKYYTVT KGDMERHCAT
910 920 930 940 950
KKHKGRVEIE ASGKHSSDII VGPEGGSLEA GKKNAGSAVT MSDEHANKPA
960 970 980 990 1000
ESPTSVLEKP DRGNSIEAEV ENVFHSLDGE VNSHLLDKKE QISSEPEDFA
1010 1020 1030 1040 1050
QPGDVYSQRD VTGTGENKCL HCEFSAHSSA SLELHVKRKH TKEFEFYCMA
1060 1070 1080 1090 1100
CDYYAVTRRE MTRHAATEKH KMKRQSYLNS ANVEAGSADM SKNIIMPEEE
1110 1120 1130 1140 1150
HQQNSEEFQI ISGQPSDTLK SRNAADCSIL NENTNLDMSK VLCAADSVEV
1160 1170 1180 1190 1200
ETEEESNFNE DHSFCETFQQ APVKDKVRKP EEMMSLTMSS NYGSPSRFQN
1210 1220 1230 1240 1250
ENSGSSALNC ETAKKNHEIS NDAGELRVHC EGEGGNAGDG GGVVPHRHLC
1260 1270 1280 1290 1300
PVTLDGERSA ESPVLVVTRI TREQGNLESG GQNRVARGHG LEDLKGVQED
1310 1320 1330 1340 1350
PVLGNKEILM NSQHETEFIL EEDGPASDST VESSDVYETI ISIDDKGQAM
1360 1370 1380 1390 1400
YSFGRFDSSI IRIKNPEDGE LIDQSEEGLI ATGVRISELP LKDCAQGVKK
1410 1420 1430 1440 1450
KKSEGSSIGE STRIRCDDCG FLADGLSGLN VHIAMKHPTK EKHFHCLLCG
1460 1470 1480 1490 1500
KSFYTESNLH QHLASAGHMR NEQASVEELP EGGATFKCVK CTEPFDSEQN
1510 1520 1530 1540 1550
LFLHIKGQHE ELLREVNKYI VEDTEQINRE REENQGNVCK YCGKMCRSSN
1560 1570 1580 1590 1600
SMAFLAHIRT HTGSKPFKCK ICHFATAQLG DARNHVKRHL GMREYKCHVC
1610 1620 1630 1640 1650
GVAFVMKKHL NTHLLGKHGV GTPKERKFTC HLCDRSFTEK WALNNHMKLH
1660 1670 1680 1690 1700
TGEKPFKCTW PTCHYSFLTA SAMKDHYRTH TGEKSFLCDL CGFAGGTRHA
1710 1720 1730 1740 1750
LTKHRRQHTG EKPFKCDECN FASTTQSHLT RHKRVHTGEK PYRCPWCDYR
1760 1770 1780 1790 1800
SNCAENIRKH ILHTGKHEGV KMYNCPKCDY GTNVPVEFRN HLKEQHPDIE
1810 1820 1830 1840 1850
NPDLAYLHAG IVSKSYECRL KGQGATFVET DSPFTAAALA EEPLVKEKPL
1860 1870 1880 1890 1900
RSSRRPAPPP EQVQQVIIFQ GYDGEFALDP SVEETAAATL QTLAMAGQVA
1910 1920 1930 1940 1950
RVVHITEDGQ VIATSQSGAH VGSVVPGPIL PEQLADGATQ VVVVGGSMEG
1960 1970 1980 1990 2000
HGMDESLSPG GAVIQQVTKQ EILNLSEAGV APPEASSALD ALLCAVTELG
2010 2020 2030 2040 2050
EVEGRAGLEE QGRPGAKDVL IQLPGQEVSH VAADPEAPEI QMFPQAQESP
2060 2070 2080 2090 2100
AAVEVLTQVV HPSAAMASQE RAQVAFKKMV QGVLQFAVCD TAAAGQLVKD
2110 2120 2130 2140 2150
GVTQVVVSEE GAVHMVAGEG AQIIMQEAQG EHMDLVESDG EISQIIVTEE
2160 2170 2180 2190 2200
LVQAMVQESS GGFSEGTTHY ILTELPPGVQ DEPGLYSHTV LETADSQELL
2210 2220 2230 2240
QAGATLGTEA GAPSRAEQLA SVVIYTQEGS SAAAAIQSQR ESSELQEA
Length:2,248
Mass (Da):247,367
Last modified:October 23, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1AE958917F5F7B91
GO
Isoform 2 (identifier: Q9C0G0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1811-1815: IVSKS → KGQKL
     1816-2248: Missing.

Show »
Length:1,815
Mass (Da):202,418
Checksum:i4C5D56BA3F87F5FD
GO
Isoform 3 (identifier: Q9C0G0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1625-1660: ERKFTCHLCDRSFTEKWALNNHMKLHTGEKPFKCTW → ERVKVAYRKIGTLPGIQNNRNASSASEAQSLCEHFS
     1661-2248: Missing.

Show »
Length:1,660
Mass (Da):184,081
Checksum:i8A585EBEA30D9E8D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WV78A0A087WV78_HUMAN
Zinc finger protein 407
ZNF407
137Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WYH1A0A087WYH1_HUMAN
Zinc finger protein 407
ZNF407
129Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA91077 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA91080 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti988K → E in BAA91077 (PubMed:14702039).Curated1
Sequence conflicti1297V → D in BAA91077 (PubMed:14702039).Curated1
Sequence conflicti1353F → S in BAA91077 (PubMed:14702039).Curated1
Sequence conflicti1415R → C in BAA91077 (PubMed:14702039).Curated1
Sequence conflicti1520I → V in BAA91077 (PubMed:14702039).Curated1
Sequence conflicti1584N → D in BAA91080 (PubMed:14702039).Curated1
Sequence conflicti2181D → G in AK023901 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05282069N → S. Corresponds to variant dbSNP:rs3794942EnsemblClinVar.1
Natural variantiVAR_052821512G → R. Corresponds to variant dbSNP:rs7227263EnsemblClinVar.1
Natural variantiVAR_036694972N → T. Corresponds to variant dbSNP:rs948615EnsemblClinVar.1
Natural variantiVAR_0619451259S → L. Corresponds to variant dbSNP:rs34048449Ensembl.1
Natural variantiVAR_0528221913A → T. Corresponds to variant dbSNP:rs17056248EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0288431625 – 1660ERKFT…FKCTW → ERVKVAYRKIGTLPGIQNNR NASSASEAQSLCEHFS in isoform 3. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_0288441661 – 2248Missing in isoform 3. 1 PublicationAdd BLAST588
Alternative sequenceiVSP_0288451811 – 1815IVSKS → KGQKL in isoform 2. 1 Publication5
Alternative sequenceiVSP_0288461816 – 2248Missing in isoform 2. 1 PublicationAdd BLAST433

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC138660 Genomic DNA No translation available.
AC091589 Genomic DNA No translation available.
AC023380 Genomic DNA No translation available.
AC100783 Genomic DNA No translation available.
AC015819 Genomic DNA No translation available.
AK000314 mRNA Translation: BAA91077.1 Different initiation.
AK000317 mRNA Translation: BAA91080.1 Different initiation.
AK023901 mRNA No translation available.
AK056288 mRNA Translation: BAB71139.1
AB051490 mRNA Translation: BAB21794.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS45885.1 [Q9C0G0-1]
CCDS54191.1 [Q9C0G0-3]
CCDS58634.1 [Q9C0G0-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001139661.1, NM_001146189.1 [Q9C0G0-2]
NP_001139662.1, NM_001146190.1 [Q9C0G0-3]
NP_060227.2, NM_017757.2 [Q9C0G0-1]
XP_005266783.1, XM_005266726.4 [Q9C0G0-1]
XP_011524370.1, XM_011526068.2 [Q9C0G0-1]
XP_011524372.1, XM_011526070.1 [Q9C0G0-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000299687; ENSP00000299687; ENSG00000215421 [Q9C0G0-1]
ENST00000309902; ENSP00000310359; ENSG00000215421 [Q9C0G0-3]
ENST00000577538; ENSP00000463270; ENSG00000215421 [Q9C0G0-2]
ENST00000582337; ENSP00000462348; ENSG00000215421 [Q9C0G0-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55628

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55628

UCSC genome browser

More...
UCSCi
uc002llw.3 human [Q9C0G0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC138660 Genomic DNA No translation available.
AC091589 Genomic DNA No translation available.
AC023380 Genomic DNA No translation available.
AC100783 Genomic DNA No translation available.
AC015819 Genomic DNA No translation available.
AK000314 mRNA Translation: BAA91077.1 Different initiation.
AK000317 mRNA Translation: BAA91080.1 Different initiation.
AK023901 mRNA No translation available.
AK056288 mRNA Translation: BAB71139.1
AB051490 mRNA Translation: BAB21794.1
CCDSiCCDS45885.1 [Q9C0G0-1]
CCDS54191.1 [Q9C0G0-3]
CCDS58634.1 [Q9C0G0-2]
RefSeqiNP_001139661.1, NM_001146189.1 [Q9C0G0-2]
NP_001139662.1, NM_001146190.1 [Q9C0G0-3]
NP_060227.2, NM_017757.2 [Q9C0G0-1]
XP_005266783.1, XM_005266726.4 [Q9C0G0-1]
XP_011524370.1, XM_011526068.2 [Q9C0G0-1]
XP_011524372.1, XM_011526070.1 [Q9C0G0-3]

3D structure databases

SMRiQ9C0G0
ModBaseiSearch...

Protein-protein interaction databases

BioGridi120767, 7 interactors
IntActiQ9C0G0, 1 interactor
STRINGi9606.ENSP00000299687

PTM databases

iPTMnetiQ9C0G0
PhosphoSitePlusiQ9C0G0

Polymorphism and mutation databases

BioMutaiZNF407
DMDMi160358927

Proteomic databases

EPDiQ9C0G0
jPOSTiQ9C0G0
MassIVEiQ9C0G0
MaxQBiQ9C0G0
PaxDbiQ9C0G0
PeptideAtlasiQ9C0G0
PRIDEiQ9C0G0
ProteomicsDBi80031 [Q9C0G0-1]
80032 [Q9C0G0-2]
80033 [Q9C0G0-3]

Genome annotation databases

EnsembliENST00000299687; ENSP00000299687; ENSG00000215421 [Q9C0G0-1]
ENST00000309902; ENSP00000310359; ENSG00000215421 [Q9C0G0-3]
ENST00000577538; ENSP00000463270; ENSG00000215421 [Q9C0G0-2]
ENST00000582337; ENSP00000462348; ENSG00000215421 [Q9C0G0-3]
GeneIDi55628
KEGGihsa:55628
UCSCiuc002llw.3 human [Q9C0G0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55628
DisGeNETi55628
EuPathDBiHostDB:ENSG00000215421.9

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZNF407
HGNCiHGNC:19904 ZNF407
HPAiHPA028255
HPA041673
MIMi615894 gene
neXtProtiNX_Q9C0G0
OpenTargetsiENSG00000215421
PharmGKBiPA134942906

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00940000156446
HOGENOMiHOG000155792
InParanoidiQ9C0G0
OrthoDBi1318335at2759
PhylomeDBiQ9C0G0
TreeFamiTF350895

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ZNF407 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55628
PharosiQ9C0G0 Tdark

Protein Ontology

More...
PROi
PR:Q9C0G0
RNActiQ9C0G0 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000215421 Expressed in 198 organ(s), highest expression level in secondary oocyte
ExpressionAtlasiQ9C0G0 baseline and differential
GenevisibleiQ9C0G0 HS

Family and domain databases

InterProiView protein in InterPro
IPR003604 Matrin/U1-like-C_Znf_C2H2
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00096 zf-C2H2, 2 hits
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 25 hits
SM00451 ZnF_U1, 7 hits
SUPFAMiSSF57667 SSF57667, 5 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 8 hits
PS50157 ZINC_FINGER_C2H2_2, 9 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZN407_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9C0G0
Secondary accession number(s): B5MD54
, Q96MY0, Q9H8A1, Q9NXD4, Q9NXD7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 19, 2003
Last sequence update: October 23, 2007
Last modified: December 11, 2019
This is version 145 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again