Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Centrosomal protein of 44 kDa

Gene

CEP44

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Centrosomal protein of 44 kDa
Short name:
Cep44
Alternative name(s):
HBV PreS1-transactivated protein 3
Short name:
PS1TP3
Gene namesi
Name:CEP44
Synonyms:KIAA1712
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000164118.12
HGNCiHGNC:29356 CEP44
neXtProtiNX_Q9C0F1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000164118
PharmGKBiPA134933992

Polymorphism and mutation databases

BioMutaiCEP44
DMDMi152032537

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002937221 – 390Centrosomal protein of 44 kDaAdd BLAST390

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei331PhosphoserineCombined sources1
Modified residuei345PhosphoserineCombined sources1
Modified residuei346PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9C0F1
MaxQBiQ9C0F1
PaxDbiQ9C0F1
PeptideAtlasiQ9C0F1
PRIDEiQ9C0F1
ProteomicsDBi80028
80029 [Q9C0F1-2]

PTM databases

iPTMnetiQ9C0F1
PhosphoSitePlusiQ9C0F1

Expressioni

Gene expression databases

BgeeiENSG00000164118 Expressed in 194 organ(s), highest expression level in corpus callosum
CleanExiHS_KIAA1712
ExpressionAtlasiQ9C0F1 baseline and differential
GenevisibleiQ9C0F1 HS

Organism-specific databases

HPAiHPA041515
HPA041835

Interactioni

Binary interactionsi

Protein-protein interaction databases

BioGridi123315, 155 interactors
IntActiQ9C0F1, 136 interactors
MINTiQ9C0F1

Structurei

3D structure databases

ProteinModelPortaliQ9C0F1
SMRiQ9C0F1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili233 – 269Sequence analysisAdd BLAST37
Coiled coili361 – 385Sequence analysisAdd BLAST25

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IEHB Eukaryota
ENOG4111F5M LUCA
GeneTreeiENSGT00390000009873
HOGENOMiHOG000015329
HOVERGENiHBG101789
InParanoidiQ9C0F1
KOiK16761
OMAiQTMLAEC
OrthoDBiEOG091G0EI4
PhylomeDBiQ9C0F1
TreeFamiTF332994

Family and domain databases

InterProiView protein in InterPro
IPR033603 CEP44
IPR029157 CEP44_CC
PANTHERiPTHR31477 PTHR31477, 1 hit
PfamiView protein in Pfam
PF15007 CEP44, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9C0F1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATGDLKRSL RNLEQVLRLL NYPEEVDCVG LIKGDPAASL PIISYSFTSY
60 70 80 90 100
SPYVTELIME SNVELIAKND LRFIDAVYKL LRDQFNYKPI LTKKQFIQCG
110 120 130 140 150
FAEWKIQIVC DILNCVMKKH KELSSLQKIP SQQRKKISSG KSEPPLGNEK
160 170 180 190 200
ISAEAVGVDI SGRFMTSGKK KAVVIRHLYN EDNVDISEDT LSPITDVNEA
210 220 230 240 250
VDVSDLNATE IKMPEVKVPE IKAEQQDVNV NPEITALQTM LAECQENLKK
260 270 280 290 300
LTSIEKRLDC LEQKMKGKVM VDENTWTNLL SRVTLLETEM LLSKKNDEFI
310 320 330 340 350
EFNEVSEDYA SCSDMDLLNP HRKSEVERPA SIPLSSGYST ASSDSTPRAS
360 370 380 390
TVNYCGLNEI SEETTIQKME RMKKMFEETA ELLKCPNHYL
Length:390
Mass (Da):44,140
Last modified:July 10, 2007 - v2
Checksum:i5B917C1159B1B7E2
GO
Isoform 2 (identifier: Q9C0F1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     363-390: ETTIQKMERMKKMFEETAELLKCPNHYL → NFPAWSATSSCSSLSWLLRGHTSYLSSQSFAWPLSCV

Show »
Length:399
Mass (Da):44,762
Checksum:iE9B38E9A9C7ECED9
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RC25D6RC25_HUMAN
Centrosomal protein of 44 kDa
CEP44
139Annotation score:
D6RGX6D6RGX6_HUMAN
Centrosomal protein of 44 kDa
CEP44
198Annotation score:
D6RBX1D6RBX1_HUMAN
Centrosomal protein of 44 kDa
CEP44
112Annotation score:

Sequence cautioni

The sequence BAB21803 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_033116147G → S2 PublicationsCorresponds to variant dbSNP:rs4695918Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_041378363 – 390ETTIQ…PNHYL → NFPAWSATSSCSSLSWLLRG HTSYLSSQSFAWPLSCV in isoform 2. 1 PublicationAdd BLAST28

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY426674 mRNA Translation: AAR88428.1
AB051499 mRNA Translation: BAB21803.1 Different initiation.
AK094961 mRNA Translation: BAG52965.1
AK292484 mRNA Translation: BAF85173.1
AC097653 Genomic DNA No translation available.
CH471056 Genomic DNA Translation: EAX04738.1
CH471056 Genomic DNA Translation: EAX04739.1
CH471056 Genomic DNA Translation: EAX04740.1
BC038667 mRNA Translation: AAH38667.1
CCDSiCCDS34106.1 [Q9C0F1-1]
CCDS47163.1 [Q9C0F1-2]
RefSeqiNP_001035247.1, NM_001040157.2 [Q9C0F1-1]
NP_001138786.1, NM_001145314.1 [Q9C0F1-2]
XP_011530587.1, XM_011532285.2 [Q9C0F1-2]
XP_011530588.1, XM_011532286.2 [Q9C0F1-2]
XP_011530589.1, XM_011532287.2 [Q9C0F1-2]
XP_016864143.1, XM_017008654.1 [Q9C0F1-1]
XP_016864144.1, XM_017008655.1 [Q9C0F1-1]
UniGeneiHs.555989

Genome annotation databases

EnsembliENST00000296519; ENSP00000296519; ENSG00000164118 [Q9C0F1-1]
ENST00000396791; ENSP00000380009; ENSG00000164118 [Q9C0F1-1]
ENST00000426172; ENSP00000408221; ENSG00000164118 [Q9C0F1-2]
ENST00000457424; ENSP00000389427; ENSG00000164118 [Q9C0F1-2]
ENST00000503780; ENSP00000423153; ENSG00000164118 [Q9C0F1-1]
GeneIDi80817
KEGGihsa:80817
UCSCiuc003itr.4 human [Q9C0F1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY426674 mRNA Translation: AAR88428.1
AB051499 mRNA Translation: BAB21803.1 Different initiation.
AK094961 mRNA Translation: BAG52965.1
AK292484 mRNA Translation: BAF85173.1
AC097653 Genomic DNA No translation available.
CH471056 Genomic DNA Translation: EAX04738.1
CH471056 Genomic DNA Translation: EAX04739.1
CH471056 Genomic DNA Translation: EAX04740.1
BC038667 mRNA Translation: AAH38667.1
CCDSiCCDS34106.1 [Q9C0F1-1]
CCDS47163.1 [Q9C0F1-2]
RefSeqiNP_001035247.1, NM_001040157.2 [Q9C0F1-1]
NP_001138786.1, NM_001145314.1 [Q9C0F1-2]
XP_011530587.1, XM_011532285.2 [Q9C0F1-2]
XP_011530588.1, XM_011532286.2 [Q9C0F1-2]
XP_011530589.1, XM_011532287.2 [Q9C0F1-2]
XP_016864143.1, XM_017008654.1 [Q9C0F1-1]
XP_016864144.1, XM_017008655.1 [Q9C0F1-1]
UniGeneiHs.555989

3D structure databases

ProteinModelPortaliQ9C0F1
SMRiQ9C0F1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123315, 155 interactors
IntActiQ9C0F1, 136 interactors
MINTiQ9C0F1

PTM databases

iPTMnetiQ9C0F1
PhosphoSitePlusiQ9C0F1

Polymorphism and mutation databases

BioMutaiCEP44
DMDMi152032537

Proteomic databases

EPDiQ9C0F1
MaxQBiQ9C0F1
PaxDbiQ9C0F1
PeptideAtlasiQ9C0F1
PRIDEiQ9C0F1
ProteomicsDBi80028
80029 [Q9C0F1-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000296519; ENSP00000296519; ENSG00000164118 [Q9C0F1-1]
ENST00000396791; ENSP00000380009; ENSG00000164118 [Q9C0F1-1]
ENST00000426172; ENSP00000408221; ENSG00000164118 [Q9C0F1-2]
ENST00000457424; ENSP00000389427; ENSG00000164118 [Q9C0F1-2]
ENST00000503780; ENSP00000423153; ENSG00000164118 [Q9C0F1-1]
GeneIDi80817
KEGGihsa:80817
UCSCiuc003itr.4 human [Q9C0F1-1]

Organism-specific databases

CTDi80817
EuPathDBiHostDB:ENSG00000164118.12
GeneCardsiCEP44
H-InvDBiHIX0004644
HGNCiHGNC:29356 CEP44
HPAiHPA041515
HPA041835
neXtProtiNX_Q9C0F1
OpenTargetsiENSG00000164118
PharmGKBiPA134933992
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IEHB Eukaryota
ENOG4111F5M LUCA
GeneTreeiENSGT00390000009873
HOGENOMiHOG000015329
HOVERGENiHBG101789
InParanoidiQ9C0F1
KOiK16761
OMAiQTMLAEC
OrthoDBiEOG091G0EI4
PhylomeDBiQ9C0F1
TreeFamiTF332994

Miscellaneous databases

ChiTaRSiCEP44 human
GenomeRNAii80817
PROiPR:Q9C0F1

Gene expression databases

BgeeiENSG00000164118 Expressed in 194 organ(s), highest expression level in corpus callosum
CleanExiHS_KIAA1712
ExpressionAtlasiQ9C0F1 baseline and differential
GenevisibleiQ9C0F1 HS

Family and domain databases

InterProiView protein in InterPro
IPR033603 CEP44
IPR029157 CEP44_CC
PANTHERiPTHR31477 PTHR31477, 1 hit
PfamiView protein in Pfam
PF15007 CEP44, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCEP44_HUMAN
AccessioniPrimary (citable) accession number: Q9C0F1
Secondary accession number(s): A8K8W9
, A8MW11, B3KT53, D3DP42, Q8IXZ4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: July 10, 2007
Last modified: October 10, 2018
This is version 113 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again