Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Centrosomal protein of 44 kDa

Gene

CEP44

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Centrosomal protein of 44 kDa
Short name:
Cep44
Alternative name(s):
HBV PreS1-transactivated protein 3
Short name:
PS1TP3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CEP44
Synonyms:KIAA1712
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000164118.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29356 CEP44

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9C0F1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000164118

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134933992

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CEP44

Domain mapping of disease mutations (DMDM)

More...
DMDMi
152032537

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002937221 – 390Centrosomal protein of 44 kDaAdd BLAST390

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei331PhosphoserineCombined sources1
Modified residuei345PhosphoserineCombined sources1
Modified residuei346PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9C0F1

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9C0F1

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9C0F1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9C0F1

PeptideAtlas

More...
PeptideAtlasi
Q9C0F1

PRoteomics IDEntifications database

More...
PRIDEi
Q9C0F1

ProteomicsDB human proteome resource

More...
ProteomicsDBi
80028
80029 [Q9C0F1-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9C0F1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9C0F1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000164118 Expressed in 194 organ(s), highest expression level in corpus callosum

CleanEx database of gene expression profiles

More...
CleanExi
HS_KIAA1712

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9C0F1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9C0F1 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA041515
HPA041835

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123315, 155 interactors

Protein interaction database and analysis system

More...
IntActi
Q9C0F1, 136 interactors

Molecular INTeraction database

More...
MINTi
Q9C0F1

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9C0F1

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9C0F1

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili233 – 269Sequence analysisAdd BLAST37
Coiled coili361 – 385Sequence analysisAdd BLAST25

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IEHB Eukaryota
ENOG4111F5M LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000009873

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000015329

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG101789

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9C0F1

KEGG Orthology (KO)

More...
KOi
K16761

Identification of Orthologs from Complete Genome Data

More...
OMAi
VNEKTWT

Database of Orthologous Groups

More...
OrthoDBi
1589624at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9C0F1

TreeFam database of animal gene trees

More...
TreeFami
TF332994

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR033603 CEP44
IPR029157 CEP44_CC

The PANTHER Classification System

More...
PANTHERi
PTHR31477 PTHR31477, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15007 CEP44, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9C0F1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATGDLKRSL RNLEQVLRLL NYPEEVDCVG LIKGDPAASL PIISYSFTSY
60 70 80 90 100
SPYVTELIME SNVELIAKND LRFIDAVYKL LRDQFNYKPI LTKKQFIQCG
110 120 130 140 150
FAEWKIQIVC DILNCVMKKH KELSSLQKIP SQQRKKISSG KSEPPLGNEK
160 170 180 190 200
ISAEAVGVDI SGRFMTSGKK KAVVIRHLYN EDNVDISEDT LSPITDVNEA
210 220 230 240 250
VDVSDLNATE IKMPEVKVPE IKAEQQDVNV NPEITALQTM LAECQENLKK
260 270 280 290 300
LTSIEKRLDC LEQKMKGKVM VDENTWTNLL SRVTLLETEM LLSKKNDEFI
310 320 330 340 350
EFNEVSEDYA SCSDMDLLNP HRKSEVERPA SIPLSSGYST ASSDSTPRAS
360 370 380 390
TVNYCGLNEI SEETTIQKME RMKKMFEETA ELLKCPNHYL
Length:390
Mass (Da):44,140
Last modified:July 10, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5B917C1159B1B7E2
GO
Isoform 2 (identifier: Q9C0F1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     363-390: ETTIQKMERMKKMFEETAELLKCPNHYL → NFPAWSATSSCSSLSWLLRGHTSYLSSQSFAWPLSCV

Show »
Length:399
Mass (Da):44,762
Checksum:iE9B38E9A9C7ECED9
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RC25D6RC25_HUMAN
Centrosomal protein of 44 kDa
CEP44
139Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RGX6D6RGX6_HUMAN
Centrosomal protein of 44 kDa
CEP44
198Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RBX1D6RBX1_HUMAN
Centrosomal protein of 44 kDa
CEP44
112Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB21803 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_033116147G → S2 PublicationsCorresponds to variant dbSNP:rs4695918Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_041378363 – 390ETTIQ…PNHYL → NFPAWSATSSCSSLSWLLRG HTSYLSSQSFAWPLSCV in isoform 2. 1 PublicationAdd BLAST28

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY426674 mRNA Translation: AAR88428.1
AB051499 mRNA Translation: BAB21803.1 Different initiation.
AK094961 mRNA Translation: BAG52965.1
AK292484 mRNA Translation: BAF85173.1
AC097653 Genomic DNA No translation available.
CH471056 Genomic DNA Translation: EAX04738.1
CH471056 Genomic DNA Translation: EAX04739.1
CH471056 Genomic DNA Translation: EAX04740.1
BC038667 mRNA Translation: AAH38667.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34106.1 [Q9C0F1-1]
CCDS47163.1 [Q9C0F1-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001035247.1, NM_001040157.2 [Q9C0F1-1]
NP_001138786.1, NM_001145314.1 [Q9C0F1-2]
XP_011530587.1, XM_011532285.2 [Q9C0F1-2]
XP_011530588.1, XM_011532286.2 [Q9C0F1-2]
XP_011530589.1, XM_011532287.2 [Q9C0F1-2]
XP_016864143.1, XM_017008654.1 [Q9C0F1-1]
XP_016864144.1, XM_017008655.1 [Q9C0F1-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.555989

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000296519; ENSP00000296519; ENSG00000164118 [Q9C0F1-1]
ENST00000396791; ENSP00000380009; ENSG00000164118 [Q9C0F1-1]
ENST00000426172; ENSP00000408221; ENSG00000164118 [Q9C0F1-2]
ENST00000457424; ENSP00000389427; ENSG00000164118 [Q9C0F1-2]
ENST00000503780; ENSP00000423153; ENSG00000164118 [Q9C0F1-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
80817

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:80817

UCSC genome browser

More...
UCSCi
uc003itr.4 human [Q9C0F1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY426674 mRNA Translation: AAR88428.1
AB051499 mRNA Translation: BAB21803.1 Different initiation.
AK094961 mRNA Translation: BAG52965.1
AK292484 mRNA Translation: BAF85173.1
AC097653 Genomic DNA No translation available.
CH471056 Genomic DNA Translation: EAX04738.1
CH471056 Genomic DNA Translation: EAX04739.1
CH471056 Genomic DNA Translation: EAX04740.1
BC038667 mRNA Translation: AAH38667.1
CCDSiCCDS34106.1 [Q9C0F1-1]
CCDS47163.1 [Q9C0F1-2]
RefSeqiNP_001035247.1, NM_001040157.2 [Q9C0F1-1]
NP_001138786.1, NM_001145314.1 [Q9C0F1-2]
XP_011530587.1, XM_011532285.2 [Q9C0F1-2]
XP_011530588.1, XM_011532286.2 [Q9C0F1-2]
XP_011530589.1, XM_011532287.2 [Q9C0F1-2]
XP_016864143.1, XM_017008654.1 [Q9C0F1-1]
XP_016864144.1, XM_017008655.1 [Q9C0F1-1]
UniGeneiHs.555989

3D structure databases

ProteinModelPortaliQ9C0F1
SMRiQ9C0F1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123315, 155 interactors
IntActiQ9C0F1, 136 interactors
MINTiQ9C0F1

PTM databases

iPTMnetiQ9C0F1
PhosphoSitePlusiQ9C0F1

Polymorphism and mutation databases

BioMutaiCEP44
DMDMi152032537

Proteomic databases

EPDiQ9C0F1
jPOSTiQ9C0F1
MaxQBiQ9C0F1
PaxDbiQ9C0F1
PeptideAtlasiQ9C0F1
PRIDEiQ9C0F1
ProteomicsDBi80028
80029 [Q9C0F1-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000296519; ENSP00000296519; ENSG00000164118 [Q9C0F1-1]
ENST00000396791; ENSP00000380009; ENSG00000164118 [Q9C0F1-1]
ENST00000426172; ENSP00000408221; ENSG00000164118 [Q9C0F1-2]
ENST00000457424; ENSP00000389427; ENSG00000164118 [Q9C0F1-2]
ENST00000503780; ENSP00000423153; ENSG00000164118 [Q9C0F1-1]
GeneIDi80817
KEGGihsa:80817
UCSCiuc003itr.4 human [Q9C0F1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
80817
EuPathDBiHostDB:ENSG00000164118.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CEP44

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0004644
HGNCiHGNC:29356 CEP44
HPAiHPA041515
HPA041835
neXtProtiNX_Q9C0F1
OpenTargetsiENSG00000164118
PharmGKBiPA134933992

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IEHB Eukaryota
ENOG4111F5M LUCA
GeneTreeiENSGT00390000009873
HOGENOMiHOG000015329
HOVERGENiHBG101789
InParanoidiQ9C0F1
KOiK16761
OMAiVNEKTWT
OrthoDBi1589624at2759
PhylomeDBiQ9C0F1
TreeFamiTF332994

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CEP44 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
80817

Protein Ontology

More...
PROi
PR:Q9C0F1

Gene expression databases

BgeeiENSG00000164118 Expressed in 194 organ(s), highest expression level in corpus callosum
CleanExiHS_KIAA1712
ExpressionAtlasiQ9C0F1 baseline and differential
GenevisibleiQ9C0F1 HS

Family and domain databases

InterProiView protein in InterPro
IPR033603 CEP44
IPR029157 CEP44_CC
PANTHERiPTHR31477 PTHR31477, 1 hit
PfamiView protein in Pfam
PF15007 CEP44, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCEP44_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9C0F1
Secondary accession number(s): A8K8W9
, A8MW11, B3KT53, D3DP42, Q8IXZ4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: July 10, 2007
Last modified: January 16, 2019
This is version 115 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again