Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 141 (16 Oct 2019)
Sequence version 4 (28 Mar 2018)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Glutamate receptor-interacting protein 2

Gene

GRIP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role as a localized scaffold for the assembly of a multiprotein signaling complex and as mediator of the trafficking of its binding partners at specific subcellular location in neurons.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-416993 Trafficking of GluR2-containing AMPA receptors

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Glutamate receptor-interacting protein 2Curated
Short name:
GRIP-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GRIP2Imported
Synonyms:KIAA17191 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:23841 GRIP2

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9C0E4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000144596

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9C0E4

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
GRIP2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000838521 – 1043Glutamate receptor-interacting protein 2Add BLAST1043

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei38PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9C0E4

PeptideAtlas

More...
PeptideAtlasi
Q9C0E4

PRoteomics IDEntifications database

More...
PRIDEi
Q9C0E4

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
80020 [Q9C0E4-1]
80021 [Q9C0E4-2]
80022 [Q9C0E4-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9C0E4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9C0E4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000144596 Expressed in 162 organ(s), highest expression level in heart left ventricle

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9C0E4 baseline and differential

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA035673

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with EFNB1, EFNB3, GRIA2, GRIA3, CSPG4 and GRIPAP1. Can form homomultimers and heteromultimers with GRIP1 (By similarity).

Interacts with the C-terminal tail of PRLHR.

By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123330, 6 interactors

Protein interaction database and analysis system

More...
IntActi
Q9C0E4, 6 interactors

Molecular INTeraction database

More...
MINTi
Q9C0E4

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000480660

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11043
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9C0E4

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9C0E4

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini48 – 131PDZ 1PROSITE-ProRule annotationAdd BLAST84
Domaini148 – 234PDZ 2PROSITE-ProRule annotationAdd BLAST87
Domaini248 – 332PDZ 3PROSITE-ProRule annotationAdd BLAST85
Domaini456 – 545PDZ 4PROSITE-ProRule annotationAdd BLAST90
Domaini557 – 641PDZ 5PROSITE-ProRule annotationAdd BLAST85
Domaini656 – 738PDZ 6PROSITE-ProRule annotationAdd BLAST83
Domaini941 – 1023PDZ 7PROSITE-ProRule annotationAdd BLAST83

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

PDZ 5 mediates the C-terminal binding of GRIA2 and GRIA3. PDZ 6 mediates interaction with the PDZ recognition motif of EFNB1. PDZ 7 mediates interaction with CSPG4 (By similarity).By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the GRIP2 family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155615

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9C0E4

KEGG Orthology (KO)

More...
KOi
K20251

Database of Orthologous Groups

More...
OrthoDBi
65191at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9C0E4

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR030029 GRIP2
IPR001478 PDZ
IPR041489 PDZ_6
IPR036034 PDZ_sf

The PANTHER Classification System

More...
PANTHERi
PTHR46227:SF4 PTHR46227:SF4, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00595 PDZ, 6 hits
PF17820 PDZ_6, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00228 PDZ, 7 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50156 SSF50156, 7 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50106 PDZ, 7 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9C0E4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLCGLSRETP GEADDGPYSK GGKDAGGADV SLACRRQSIP EEFRGITVVE
60 70 80 90 100
LIKKEGSTLG LTISGGTDKD GKPRVSNLRP GGLAARSDLL NIGDYIRSVN
110 120 130 140 150
GIHLTRLRHD EIITLLKNVG ERVVLEVEYE LPPPAPENNP RIISKTVDVS
160 170 180 190 200
LYKEGNSFGF VLRGGAHEDG HKSRPLVLTY VRPGGPADRE GSLKVGDRLL
210 220 230 240 250
SVDGIPLHGA SHATALATLR QCSHEALFQV EYDVATPDTV ANASGPLMVE
260 270 280 290 300
IVKTPGSALG ISLTTTSLRN KSVITIDRIK PASVVDRSGA LHPGDHILSI
310 320 330 340 350
DGTSMEHCSL LEATKLLASI SEKVRLEILP VPQSQRPLRP SEAVKVQRSE
360 370 380 390 400
QLHRWDPCVP SCHSPRPGHC RMPTWATPAG QDQSRSLSST PFSSPTLNHA
410 420 430 440 450
FSCNNPSTLP RGSQPMSPRT TMGRRRQRRR EHKSSLSLAS STVGPGGQIV
460 470 480 490 500
HTETTEVVLC GDPLSGFGLQ LQGGIFATET LSSPPLVCFI EPDSPAERCG
510 520 530 540 550
LLQVGDRVLS INGIATEDGT MEEANQLLRD AALAHKVVLE VEFDVAESVI
560 570 580 590 600
PSSGTFHVKL PKKRSVELGI TISSASRKRG EPLIISDIKK GSVAHRTGTL
610 620 630 640 650
EPGDKLLAID NIRLDNCPME DAVQILRQCE DLVKLKIRKD EDNSDELETT
660 670 680 690 700
GAVSYTVELK RYGGPLGITI SGTEEPFDPI VISGLTKRGL AERTGAIHVG
710 720 730 740 750
DRILAINNVS LKGRPLSEAI HLLQVAGETV TLKIKKQLDR PLLPRKSGSL
760 770 780 790 800
SETSDADEDP ADALKGGLPA ARFSPAVPSV DSAVESWDSS ATEGGFGGPG
810 820 830 840 850
SYTPQAAARG TTPQERRPGW LRGSPPPTEP RRTSYTPTPA DESFPEEEEE
860 870 880 890 900
DDWEPPTSPA PGPAREEGFW RMFGEALEDL ESCGQSELLR ELEASIMTGT
910 920 930 940 950
VQRVALEGRP GHRPWQRGRE VRASPAEMEE LLLPTPLEMH KVTLHKDPMR
960 970 980 990 1000
HDFGFSVSDG LLEKGVYVHT VRPDGPAHRG GLQPFDRVLQ VNHVRTRDFD
1010 1020 1030 1040
CCLAVPLLAE AGDVLELIIS RKPHTAHSSR APRSPGPSSP RML
Length:1,043
Mass (Da):112,573
Last modified:March 28, 2018 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i24686D50E5FB827F
GO
Isoform 2 (identifier: Q9C0E4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     858-873: SPAPGPAREEGFWRMF → RHPVSPLSTPSHLPLF
     874-1043: Missing.

Note: Due to intron retention. No experimental confirmation available.
Show »
Length:873
Mass (Da):93,696
Checksum:iB64A2AF4EC2D544D
GO
Isoform 3 (identifier: Q9C0E4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MLCGLSRETPGE → QEWKRKWNSAFPSFSP
     135-170: APENNPRIISKTVDVSLYKEGNSFGFVLRGGAHEDG → GGCPWTGNFLHCLGCGWTRLPPHQGLGGRDHARWSG
     171-1043: Missing.

Note: Incomplete sequence. Due to intron retention. No experimental confirmation available.
Show »
Length:174
Mass (Da):18,938
Checksum:iA76F1C4FF8B51B74
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WX15A0A087WX15_HUMAN
Glutamate receptor-interacting prot...
GRIP2
1,140Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GWJ3A0A1B0GWJ3_HUMAN
Glutamate receptor-interacting prot...
GRIP2
1,048Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WYB3A0A087WYB3_HUMAN
Glutamate receptor-interacting prot...
GRIP2
332Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GUL8A0A1B0GUL8_HUMAN
Glutamate receptor-interacting prot...
GRIP2
141Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB21810 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti850E → G in BAB21810 (PubMed:10574462).1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0097541 – 12MLCGL…ETPGE → QEWKRKWNSAFPSFSP in isoform 3. CuratedAdd BLAST12
Alternative sequenceiVSP_009755135 – 170APENN…AHEDG → GGCPWTGNFLHCLGCGWTRL PPHQGLGGRDHARWSG in isoform 3. CuratedAdd BLAST36
Alternative sequenceiVSP_009756171 – 1043Missing in isoform 3. CuratedAdd BLAST873
Alternative sequenceiVSP_009757858 – 873SPAPG…FWRMF → RHPVSPLSTPSHLPLF in isoform 2. CuratedAdd BLAST16
Alternative sequenceiVSP_009758874 – 1043Missing in isoform 2. CuratedAdd BLAST170

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB051506 mRNA Translation: BAB21810.2 Different initiation.
ABBA01025158 Genomic DNA No translation available.
AC090952 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW64198.1
AK074145 mRNA Translation: BAB84971.1
AK024507 mRNA Translation: BAB15797.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS46766.2 [Q9C0E4-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001073892.3, NM_001080423.3 [Q9C0E4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000621039; ENSP00000478352; ENSG00000144596 [Q9C0E4-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
80852

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:80852

UCSC genome browser

More...
UCSCi
uc062gzy.1 human

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB051506 mRNA Translation: BAB21810.2 Different initiation.
ABBA01025158 Genomic DNA No translation available.
AC090952 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW64198.1
AK074145 mRNA Translation: BAB84971.1
AK024507 mRNA Translation: BAB15797.1
CCDSiCCDS46766.2 [Q9C0E4-1]
RefSeqiNP_001073892.3, NM_001080423.3 [Q9C0E4-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1V62NMR-A238-341[»]
1X5RNMR-A446-544[»]
SMRiQ9C0E4
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi123330, 6 interactors
IntActiQ9C0E4, 6 interactors
MINTiQ9C0E4
STRINGi9606.ENSP00000480660

PTM databases

iPTMnetiQ9C0E4
PhosphoSitePlusiQ9C0E4

Polymorphism and mutation databases

BioMutaiGRIP2

Proteomic databases

MassIVEiQ9C0E4
PeptideAtlasiQ9C0E4
PRIDEiQ9C0E4
ProteomicsDBi80020 [Q9C0E4-1]
80021 [Q9C0E4-2]
80022 [Q9C0E4-3]

Genome annotation databases

EnsembliENST00000621039; ENSP00000478352; ENSG00000144596 [Q9C0E4-1]
GeneIDi80852
KEGGihsa:80852
UCSCiuc062gzy.1 human

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
80852

GeneCards: human genes, protein and diseases

More...
GeneCardsi
GRIP2
HGNCiHGNC:23841 GRIP2
HPAiHPA035673
neXtProtiNX_Q9C0E4
OpenTargetsiENSG00000144596

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00940000155615
InParanoidiQ9C0E4
KOiK20251
OrthoDBi65191at2759
PhylomeDBiQ9C0E4

Enzyme and pathway databases

ReactomeiR-HSA-416993 Trafficking of GluR2-containing AMPA receptors

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
GRIP2 human
EvolutionaryTraceiQ9C0E4

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
GRIP2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
80852
PharosiQ9C0E4

Protein Ontology

More...
PROi
PR:Q9C0E4

Gene expression databases

BgeeiENSG00000144596 Expressed in 162 organ(s), highest expression level in heart left ventricle
ExpressionAtlasiQ9C0E4 baseline and differential

Family and domain databases

InterProiView protein in InterPro
IPR030029 GRIP2
IPR001478 PDZ
IPR041489 PDZ_6
IPR036034 PDZ_sf
PANTHERiPTHR46227:SF4 PTHR46227:SF4, 1 hit
PfamiView protein in Pfam
PF00595 PDZ, 6 hits
PF17820 PDZ_6, 1 hit
SMARTiView protein in SMART
SM00228 PDZ, 7 hits
SUPFAMiSSF50156 SSF50156, 7 hits
PROSITEiView protein in PROSITE
PS50106 PDZ, 7 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGRIP2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9C0E4
Secondary accession number(s): A0A087WU38, Q8TEH9, Q9H7H3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 29, 2004
Last sequence update: March 28, 2018
Last modified: October 16, 2019
This is version 141 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again