Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Glutamate receptor-interacting protein 2

Gene

GRIP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May play a role as a localized scaffold for the assembly of a multiprotein signaling complex and as mediator of the trafficking of its binding partners at specific subcellular location in neurons.By similarity

GO - Molecular functioni

Enzyme and pathway databases

ReactomeiR-HSA-416993 Trafficking of GluR2-containing AMPA receptors

Names & Taxonomyi

Protein namesi
Recommended name:
Glutamate receptor-interacting protein 2Curated
Short name:
GRIP-2
Gene namesi
Name:GRIP2Imported
Synonyms:KIAA17191 Publication
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000144596.11
HGNCiHGNC:23841 GRIP2
neXtProtiNX_Q9C0E4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi80852
OpenTargetsiENSG00000144596

Polymorphism and mutation databases

BioMutaiGRIP2

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000838521 – 1043Glutamate receptor-interacting protein 2Add BLAST1043

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei38PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PeptideAtlasiQ9C0E4
PRIDEiQ9C0E4
ProteomicsDBi80020
80021 [Q9C0E4-2]
80022 [Q9C0E4-3]

PTM databases

iPTMnetiQ9C0E4
PhosphoSitePlusiQ9C0E4

Expressioni

Gene expression databases

BgeeiENSG00000144596
CleanExiHS_GRIP2

Organism-specific databases

HPAiHPA035673

Interactioni

Subunit structurei

Interacts with EFNB1, EFNB3, GRIA2, GRIA3, CSPG4 and GRIPAP1. Can form homomultimers and heteromultimers with GRIP1 (By similarity). Interacts with the C-terminal tail of PRLHR.By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi123330, 6 interactors
IntActiQ9C0E4, 6 interactors
MINTiQ9C0E4

Structurei

Secondary structure

11043
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi243 – 252Combined sources10
Beta strandi262 – 266Combined sources5
Beta strandi269 – 271Combined sources3
Beta strandi273 – 278Combined sources6
Helixi284 – 288Combined sources5
Beta strandi296 – 300Combined sources5
Helixi310 – 318Combined sources9
Beta strandi321 – 328Combined sources8
Beta strandi451 – 459Combined sources9
Turni463 – 465Combined sources3
Beta strandi469 – 472Combined sources4
Beta strandi477 – 480Combined sources4
Beta strandi486 – 490Combined sources5
Helixi495 – 498Combined sources4
Beta strandi509 – 511Combined sources3
Beta strandi514 – 516Combined sources3
Helixi521 – 532Combined sources12
Turni533 – 535Combined sources3
Beta strandi537 – 543Combined sources7

3D structure databases

ProteinModelPortaliQ9C0E4
SMRiQ9C0E4
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9C0E4

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini48 – 131PDZ 1PROSITE-ProRule annotationAdd BLAST84
Domaini148 – 234PDZ 2PROSITE-ProRule annotationAdd BLAST87
Domaini248 – 332PDZ 3PROSITE-ProRule annotationAdd BLAST85
Domaini456 – 545PDZ 4PROSITE-ProRule annotationAdd BLAST90
Domaini557 – 641PDZ 5PROSITE-ProRule annotationAdd BLAST85
Domaini656 – 738PDZ 6PROSITE-ProRule annotationAdd BLAST83
Domaini941 – 1023PDZ 7PROSITE-ProRule annotationAdd BLAST83

Domaini

PDZ 5 mediates the C-terminal binding of GRIA2 and GRIA3. PDZ 6 mediates interaction with the PDZ recognition motif of EFNB1. PDZ 7 mediates interaction with CSPG4 (By similarity).By similarity

Sequence similaritiesi

Belongs to the GRIP2 family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

GeneTreeiENSGT00920000149078
HOVERGENiHBG051841
InParanoidiQ9C0E4
KOiK20251
PhylomeDBiQ9C0E4

Family and domain databases

InterProiView protein in InterPro
IPR030029 GRIP2
IPR001478 PDZ
IPR036034 PDZ_sf
PANTHERiPTHR10316:SF42 PTHR10316:SF42, 1 hit
PfamiView protein in Pfam
PF00595 PDZ, 7 hits
SMARTiView protein in SMART
SM00228 PDZ, 7 hits
SUPFAMiSSF50156 SSF50156, 7 hits
PROSITEiView protein in PROSITE
PS50106 PDZ, 7 hits

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9C0E4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLCGLSRETP GEADDGPYSK GGKDAGGADV SLACRRQSIP EEFRGITVVE
60 70 80 90 100
LIKKEGSTLG LTISGGTDKD GKPRVSNLRP GGLAARSDLL NIGDYIRSVN
110 120 130 140 150
GIHLTRLRHD EIITLLKNVG ERVVLEVEYE LPPPAPENNP RIISKTVDVS
160 170 180 190 200
LYKEGNSFGF VLRGGAHEDG HKSRPLVLTY VRPGGPADRE GSLKVGDRLL
210 220 230 240 250
SVDGIPLHGA SHATALATLR QCSHEALFQV EYDVATPDTV ANASGPLMVE
260 270 280 290 300
IVKTPGSALG ISLTTTSLRN KSVITIDRIK PASVVDRSGA LHPGDHILSI
310 320 330 340 350
DGTSMEHCSL LEATKLLASI SEKVRLEILP VPQSQRPLRP SEAVKVQRSE
360 370 380 390 400
QLHRWDPCVP SCHSPRPGHC RMPTWATPAG QDQSRSLSST PFSSPTLNHA
410 420 430 440 450
FSCNNPSTLP RGSQPMSPRT TMGRRRQRRR EHKSSLSLAS STVGPGGQIV
460 470 480 490 500
HTETTEVVLC GDPLSGFGLQ LQGGIFATET LSSPPLVCFI EPDSPAERCG
510 520 530 540 550
LLQVGDRVLS INGIATEDGT MEEANQLLRD AALAHKVVLE VEFDVAESVI
560 570 580 590 600
PSSGTFHVKL PKKRSVELGI TISSASRKRG EPLIISDIKK GSVAHRTGTL
610 620 630 640 650
EPGDKLLAID NIRLDNCPME DAVQILRQCE DLVKLKIRKD EDNSDELETT
660 670 680 690 700
GAVSYTVELK RYGGPLGITI SGTEEPFDPI VISGLTKRGL AERTGAIHVG
710 720 730 740 750
DRILAINNVS LKGRPLSEAI HLLQVAGETV TLKIKKQLDR PLLPRKSGSL
760 770 780 790 800
SETSDADEDP ADALKGGLPA ARFSPAVPSV DSAVESWDSS ATEGGFGGPG
810 820 830 840 850
SYTPQAAARG TTPQERRPGW LRGSPPPTEP RRTSYTPTPA DESFPEEEEE
860 870 880 890 900
DDWEPPTSPA PGPAREEGFW RMFGEALEDL ESCGQSELLR ELEASIMTGT
910 920 930 940 950
VQRVALEGRP GHRPWQRGRE VRASPAEMEE LLLPTPLEMH KVTLHKDPMR
960 970 980 990 1000
HDFGFSVSDG LLEKGVYVHT VRPDGPAHRG GLQPFDRVLQ VNHVRTRDFD
1010 1020 1030 1040
CCLAVPLLAE AGDVLELIIS RKPHTAHSSR APRSPGPSSP RML
Length:1,043
Mass (Da):112,573
Last modified:March 28, 2018 - v4
Checksum:i24686D50E5FB827F
GO
Isoform 2 (identifier: Q9C0E4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     858-873: SPAPGPAREEGFWRMF → RHPVSPLSTPSHLPLF
     874-1043: Missing.

Note: Due to intron retention. No experimental confirmation available.
Show »
Length:873
Mass (Da):93,696
Checksum:iB64A2AF4EC2D544D
GO
Isoform 3 (identifier: Q9C0E4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MLCGLSRETPGE → QEWKRKWNSAFPSFSP
     135-170: APENNPRIISKTVDVSLYKEGNSFGFVLRGGAHEDG → GGCPWTGNFLHCLGCGWTRLPPHQGLGGRDHARWSG
     171-1043: Missing.

Note: Incomplete sequence. Due to intron retention. No experimental confirmation available.
Show »
Length:174
Mass (Da):18,938
Checksum:iA76F1C4FF8B51B74
GO

Sequence cautioni

The sequence BAB21810 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti850E → G in BAB21810 (PubMed:10574462).1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0097541 – 12MLCGL…ETPGE → QEWKRKWNSAFPSFSP in isoform 3. CuratedAdd BLAST12
Alternative sequenceiVSP_009755135 – 170APENN…AHEDG → GGCPWTGNFLHCLGCGWTRL PPHQGLGGRDHARWSG in isoform 3. CuratedAdd BLAST36
Alternative sequenceiVSP_009756171 – 1043Missing in isoform 3. CuratedAdd BLAST873
Alternative sequenceiVSP_009757858 – 873SPAPG…FWRMF → RHPVSPLSTPSHLPLF in isoform 2. CuratedAdd BLAST16
Alternative sequenceiVSP_009758874 – 1043Missing in isoform 2. CuratedAdd BLAST170

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB051506 mRNA Translation: BAB21810.2 Different initiation.
ABBA01025158 Genomic DNA No translation available.
AC090952 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW64198.1
AK074145 mRNA Translation: BAB84971.1
AK024507 mRNA Translation: BAB15797.1
RefSeqiNP_001073892.3, NM_001080423.3 [Q9C0E4-1]
UniGeneiHs.517819

Genome annotation databases

EnsembliENST00000621039; ENSP00000478352; ENSG00000144596 [Q9C0E4-1]
GeneIDi80852
KEGGihsa:80852

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiGRIP2_HUMAN
AccessioniPrimary (citable) accession number: Q9C0E4
Secondary accession number(s): A0A087WU38, Q8TEH9, Q9H7H3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 29, 2004
Last sequence update: March 28, 2018
Last modified: June 20, 2018
This is version 131 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health