Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 128 (08 May 2019)
Sequence version 3 (29 May 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Alpha-ketoglutarate-dependent dioxygenase FTO

Gene

FTO

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

RNA demethylase that mediates oxidative demethylation of different RNA species, such as mRNAs, tRNAs and snRNAs, and acts as a regulator of fat mass, adipogenesis and energy homeostasis (PubMed:22002720, PubMed:26458103, PubMed:28002401, PubMed:30197295, PubMed:26457839, PubMed:25452335). Specifically demethylates N6-methyladenosine (m6A) RNA, the most prevalent internal modification of messenger RNA (mRNA) in higher eukaryotes (PubMed:22002720, PubMed:26458103, PubMed:30197295, PubMed:26457839, PubMed:25452335). M6A demethylation by FTO affects mRNA expression and stability (PubMed:30197295). Also able to demethylate m6A in U6 small nuclear RNA (snRNA) (PubMed:30197295). Mediates demethylation of N6,2'-O-dimethyladenosine cap (m6A(m)), by demethylating the N6-methyladenosine at the second transcribed position of mRNAs and U6 snRNA (PubMed:28002401, PubMed:30197295). Demethylation of m6A(m) in the 5'-cap by FTO affects mRNA stability by promoting susceptibility to decapping (PubMed:28002401). Also acts as a tRNA demethylase by removing N1-methyladenine from various tRNAs (PubMed:30197295). Has no activity towards 1-methylguanine (PubMed:20376003). Has no detectable activity towards double-stranded DNA (PubMed:20376003). Also able to repair alkylated DNA and RNA by oxidative demethylation: demethylates single-stranded RNA containing 3-methyluracil, single-stranded DNA containing 3-methylthymine and has low demethylase activity towards single-stranded DNA containing 1-methyladenine or 3-methylcytosine (PubMed:18775698, PubMed:20376003). Ability to repair alkylated DNA and RNA is however unsure in vivo (PubMed:18775698, PubMed:20376003). Involved in the regulation of fat mass, adipogenesis and body weight, thereby contributing to the regulation of body size and body fat accumulation (PubMed:18775698, PubMed:20376003). Involved in the regulation of thermogenesis and the control of adipocyte differentiation into brown or white fat cells (PubMed:26287746). Regulates activity of the dopaminergic midbrain circuitry via its ability to demethylate m6A in mRNAs (By similarity). Plays an oncogenic role in a number of acute myeloid leukemias by enhancing leukemic oncogene-mediated cell transformation: acts by mediating m6A demethylation of target transcripts such as MYC, CEBPA, ASB2 and RARA, leading to promote their expression (PubMed:28017614, PubMed:29249359).By similarity11 Publications

Caution

According to a report, mainly mediates demethylation of N6,2'-O-dimethyladenosine cap (m6A(m)), by demethylating the N6-methyladenosine adjacent to mRNA cap, whereas it has low activity toward internal N6-methyladenosine (m6A) in mRNAs (PubMed:28002401). According to a second report, has strong activity toward internal N6-methyladenosine (m6A) in mRNAs and is able to demethylate different RNA species, such as tRNA, mRNA or small nuclear RNA (snRNA), depending on the context and subcellular location (PubMed:30197295).2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Fe2+1 PublicationNote: Binds 1 Fe2+ ion per subunit.1 Publication

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Activated by ascorbate (By similarity). Inhibited by N-oxalylglycine, fumarate and succinate (By similarity). RNA N6-methyladenosine demethylase activity is inhibited by fluorescein derivatives (PubMed:26457839). RNA N6-methyladenosine demethylase activity is selectively inhibited by meclofenamic acid; inhibition is specific to FTO and meclofenamic acid does not inhibit ALKBH5 (PubMed:25452335). Specifically inhibited by R-2-hydroxyglutarate (R-2HG), an oncometabolite that also exerts a broad antileukemic activity (PubMed:29249359). Inhibition by R-2HG leads to increased level of N6-methyladenosine-containing transcripts, leading to down-regulate expression of MYC and CEBPA transcripts (PubMed:29249359).By similarity3 Publications

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

Kcat is 8.78 min(-1) for m7Gppp(m6A(m))CA mRNA. Kcat is 7.77 min(-1) for m7Gppp(m6A)CA mRNA. Kcat is 0.54 min(-1) for GG(m6A)CU mRNA. Kcat is 0.46 min(-1) for m7GpppAC(m6) mRNA.1 Publication
  1. KM=1.34 µM for m7Gppp(m6A(m))CA mRNA1 Publication
  2. KM=16.09 µM for m7Gppp(m6ACA mRNA1 Publication
  3. KM=9.29 µM for GG(m6A)CU mRNA1 Publication
  4. KM=6.4 µM for m7GpppAC(m6) mRNA1 Publication

    pH dependencei

    Optimum pH is 5.5-6.1 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei96SubstrateCombined sources1 Publication1
    Binding sitei108SubstrateCombined sources1 Publication1
    Binding sitei205Alpha-ketoglutarateCombined sources2 Publications1
    <p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi231Iron; catalyticCombined sources4 Publications2 Publications1
    Metal bindingi233Iron; catalyticCombined sources4 Publications1 Publication1
    Binding sitei295Alpha-ketoglutarateCombined sources3 Publications1
    Metal bindingi307Iron; catalyticCombined sources4 Publications1 Publication1
    Binding sitei320Alpha-ketoglutarateCombined sources1 Publication1
    Binding sitei322Alpha-ketoglutarateCombined sources3 Publications1

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionDioxygenase, Oxidoreductase, Transferase
    LigandIron, Metal-binding

    Enzyme and pathway databases

    Reactome - a knowledgebase of biological pathways and processes

    More...
    Reactomei
    R-HSA-73943 Reversal of alkylation damage by DNA dioxygenases

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Alpha-ketoglutarate-dependent dioxygenase FTOCurated
    Alternative name(s):
    Fat mass and obesity-associated protein1 Publication
    U6 small nuclear RNA (2'-O-methyladenosine-N(6)-)-demethylase FTOCurated (EC:1.14.11.-1 Publication)
    U6 small nuclear RNA N(6)-methyladenosine-demethylase FTOCurated (EC:1.14.11.-1 Publication)
    mRNA (2'-O-methyladenosine-N(6)-)-demethylase FTOCurated (EC:1.14.11.-2 Publications)
    Short name:
    m6A(m)-demethylase FTOCurated
    mRNA N(6)-methyladenosine demethylase FTOCurated (EC:1.14.11.531 Publication3 Publications)
    tRNA N1-methyl adenine demethylase FTOCurated (EC:1.14.11.-1 Publication)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:FTO1 PublicationImported
    Synonyms:KIAA17521 Publication
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

    Organism-specific databases

    Human Gene Nomenclature Database

    More...
    HGNCi
    HGNC:24678 FTO

    Online Mendelian Inheritance in Man (OMIM)

    More...
    MIMi
    610966 gene

    neXtProt; the human protein knowledge platform

    More...
    neXtProti
    NX_Q9C0B1

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    <p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

    Growth retardation, developmental delay, and facial dysmorphism (GDFD)4 Publications
    The disease is caused by mutations affecting the gene represented in this entry.
    Disease descriptionA severe polymalformation syndrome characterized by postnatal growth retardation, microcephaly, severe psychomotor delay, functional brain deficits and characteristic facial dysmorphism. In some patients, structural brain malformations, cardiac defects, genital anomalies, and cleft palate are observed. Early death occurs by the age of 3 years.
    See also OMIM:612938
    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063252316R → Q in GDFD; has no residual normal activity, impaired ability to demethylate N(6)-methyladenosine RNAs (m6A) RNAs. 2 PublicationsCorresponds to variant dbSNP:rs121918214EnsemblClinVar.1
    Natural variantiVAR_075468319S → F in GDFD; reduced enzyme activity. 1 PublicationCorresponds to variant dbSNP:rs781028867EnsemblClinVar.1
    Natural variantiVAR_075469322R → Q in GDFD. 1 PublicationCorresponds to variant dbSNP:rs745616565Ensembl.1
    Obesity (OBESITY)2 Publications
    Disease susceptibility is associated with variations affecting the gene represented in this entry. It is unclear whether variations associated with obesity directly affect FTO function or alter the expression of adjacent genes such as IRX3, rather than FTO itself (PubMed:24646999, PubMed:26287746). A pathogenic intronic FTO variation (rs1421085) disrupts an evolutionarily conserved motif for ARID5B binding (PubMed:26287746). Loss of ARID5B binding results in overexpression of two genes distal to FTO, IRX3 and IRX5. IRX3 and IRX5 overexpression shifts pre-adipocytes differentiation from brown to white fat cells, resulting in increased lipid storage and loss of mitochondrial thermogenesis (PubMed:26287746).2 Publications
    Disease descriptionA condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat.
    See also OMIM:601665

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi96R → M or W: Almost abolishes enzyme activity. 1 Publication1
    Mutagenesisi108Y → A: Abolishes enzyme activity. 1 Publication1
    Mutagenesisi114F → D: Perturbs interaction between N-terminal and C-terminal domains and strongly reduces enzyme activity. 1 Publication1
    Mutagenesisi231 – 233HHD → AHA: Abolishes ability to demethylate N(6)-methyladenosine RNAs (m6A) RNAs. 1 Publication3
    Mutagenesisi234E → P: Abolishes enzyme activity. Abolishes ability to demethylate N(6)-methyladenosine RNAs (m6A) RNAs; when associated with Q-322. 1 Publication1
    Mutagenesisi392C → D: Perturbs interaction between N-terminal and C-terminal domains and strongly reduces enzyme activity. 1 Publication1

    Keywords - Diseasei

    Disease mutation, Obesity

    Organism-specific databases

    DisGeNET

    More...
    DisGeNETi
    79068

    MalaCards human disease database

    More...
    MalaCardsi
    FTO
    MIMi601665 phenotype
    612460 phenotype
    612938 phenotype

    Open Targets

    More...
    OpenTargetsi
    ENSG00000140718

    Orphanet; a database dedicated to information on rare diseases and orphan drugs

    More...
    Orphaneti
    210144 Lethal polymalformative syndrome, Boissel type

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...
    PharmGKBi
    PA152208656

    Chemistry databases

    ChEMBL database of bioactive drug-like small molecules

    More...
    ChEMBLi
    CHEMBL2331065

    Polymorphism and mutation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...
    BioMutai
    FTO

    Domain mapping of disease mutations (DMDM)

    More...
    DMDMi
    148841515

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002861631 – 505Alpha-ketoglutarate-dependent dioxygenase FTOAdd BLAST505

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei4PhosphothreonineCombined sources1
    Modified residuei216N6-acetyllysineCombined sources1

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...
    EPDi
    Q9C0B1

    jPOST - Japan Proteome Standard Repository/Database

    More...
    jPOSTi
    Q9C0B1

    MaxQB - The MaxQuant DataBase

    More...
    MaxQBi
    Q9C0B1

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    Q9C0B1

    PeptideAtlas

    More...
    PeptideAtlasi
    Q9C0B1

    PRoteomics IDEntifications database

    More...
    PRIDEi
    Q9C0B1

    ProteomicsDB human proteome resource

    More...
    ProteomicsDBi
    79982
    79983 [Q9C0B1-2]
    79984 [Q9C0B1-3]
    79985 [Q9C0B1-4]

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    Q9C0B1

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    Q9C0B1

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Ubiquitously expressed, with relatively high expression in adrenal glands and brain; especially in hypothalamus and pituitary (PubMed:17434869, PubMed:17496892). Highly expressed in highly expressed in acute myeloid leukemias (AML) with t(11;11)(q23;23) with KMT2A/MLL1 rearrangements, t(15;17)(q21;q21)/PML-RARA, FLT3-ITD, and/or NPM1 mutations (PubMed:28017614).3 Publications

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSG00000140718 Expressed in 236 organ(s), highest expression level in forebrain

    ExpressionAtlas, Differential and Baseline Expression

    More...
    ExpressionAtlasi
    Q9C0B1 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    Q9C0B1 HS

    Organism-specific databases

    Human Protein Atlas

    More...
    HPAi
    CAB017123
    HPA041086
    HPA068695

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Monomer (By similarity). May also exist as homodimer (By similarity).By similarity

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...
    BioGridi
    122520, 29 interactors

    Protein interaction database and analysis system

    More...
    IntActi
    Q9C0B1, 9 interactors

    STRING: functional protein association networks

    More...
    STRINGi
    9606.ENSP00000418823

    Chemistry databases

    BindingDB database of measured binding affinities

    More...
    BindingDBi
    Q9C0B1

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    Secondary structure

    1505
    Legend: HelixTurnBeta strandPDB Structure known for this area
    Show more details

    3D structure databases

    Select the link destinations:

    Protein Data Bank Europe

    More...
    PDBei

    Protein Data Bank RCSB

    More...
    RCSB PDBi

    Protein Data Bank Japan

    More...
    PDBji
    Links Updated
    PDB entryMethodResolution (Å)ChainPositionsPDBsum
    3LFMX-ray2.50A32-505[»]
    4CXWX-ray3.10A32-505[»]
    4CXXX-ray2.76A32-505[»]
    4CXYX-ray2.65A32-505[»]
    4IDZX-ray2.46A32-505[»]
    4IE0X-ray2.53A32-505[»]
    4IE4X-ray2.50A32-505[»]
    4IE5X-ray1.95A32-505[»]
    4IE6X-ray2.50A32-505[»]
    4IE7X-ray2.60A32-505[»]
    4QHOX-ray2.37A32-505[»]
    4QKNX-ray2.20A32-503[»]
    4ZS2X-ray2.16A32-505[»]
    4ZS3X-ray2.45A32-505[»]
    5DABX-ray2.10A32-505[»]
    5F8PX-ray2.20A32-502[»]

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...
    SMRi
    Q9C0B1

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Region

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni32 – 327Fe2OG dioxygenase domain1 PublicationAdd BLAST296
    Regioni213 – 224Loop L1; predicted to block binding of double-stranded DNA or RNA1 PublicationAdd BLAST12
    Regioni231 – 234Substrate bindingCombined sources1 Publication4
    Regioni316 – 318Alpha-ketoglutarate bindingCombined sources3 Publications3

    <p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

    The 3D-structure of the Fe2OG dioxygenase domain is similar to that of the Fe2OG dioxygenase domain found in the bacterial DNA repair dioxygenase alkB and its mammalian orthologs, but sequence similarity is very low. As a consequence, the domain is not detected by protein signature databases.1 Publication

    <p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Belongs to the fto family.Curated

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    ENOG410IJ5C Eukaryota
    ENOG4111PKJ LUCA

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00390000017730

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...
    HOGENOMi
    HOG000273870

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    Q9C0B1

    KEGG Orthology (KO)

    More...
    KOi
    K19469

    Database of Orthologous Groups

    More...
    OrthoDBi
    1300974at2759

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    Q9C0B1

    TreeFam database of animal gene trees

    More...
    TreeFami
    TF333296

    Family and domain databases

    Gene3D Structural and Functional Annotation of Protein Families

    More...
    Gene3Di
    1.20.58.1470, 1 hit
    2.60.120.590, 1 hit

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR037151 AlkB-like_sf
    IPR032868 FTO
    IPR024366 FTO_C
    IPR038413 FTO_C_sf
    IPR024367 FTO_cat_dom

    The PANTHER Classification System

    More...
    PANTHERi
    PTHR31291 PTHR31291, 1 hit

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF12934 FTO_CTD, 1 hit
    PF12933 FTO_NTD, 1 hit

    Simple Modular Architecture Research Tool; a protein domain database

    More...
    SMARTi
    View protein in SMART
    SM01223 FTO_NTD, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 4 described isoforms and 13 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: Q9C0B1-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MKRTPTAEER EREAKKLRLL EELEDTWLPY LTPKDDEFYQ QWQLKYPKLI
    60 70 80 90 100
    LREASSVSEE LHKEVQEAFL TLHKHGCLFR DLVRIQGKDL LTPVSRILIG
    110 120 130 140 150
    NPGCTYKYLN TRLFTVPWPV KGSNIKHTEA EIAAACETFL KLNDYLQIET
    160 170 180 190 200
    IQALEELAAK EKANEDAVPL CMSADFPRVG MGSSYNGQDE VDIKSRAAYN
    210 220 230 240 250
    VTLLNFMDPQ KMPYLKEEPY FGMGKMAVSW HHDENLVDRS AVAVYSYSCE
    260 270 280 290 300
    GPEEESEDDS HLEGRDPDIW HVGFKISWDI ETPGLAIPLH QGDCYFMLDD
    310 320 330 340 350
    LNATHQHCVL AGSQPRFSST HRVAECSTGT LDYILQRCQL ALQNVCDDVD
    360 370 380 390 400
    NDDVSLKSFE PAVLKQGEEI HNEVEFEWLR QFWFQGNRYR KCTDWWCQPM
    410 420 430 440 450
    AQLEALWKKM EGVTNAVLHE VKREGLPVEQ RNEILTAILA SLTARQNLRR
    460 470 480 490 500
    EWHARCQSRI ARTLPADQKP ECRPYWEKDD ASMPLPFDLT DIVSELRGQL

    LEAKP
    Length:505
    Mass (Da):58,282
    Last modified:May 29, 2007 - v3
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3498A92C6E6D81B1
    GO
    Isoform 2 (identifier: Q9C0B1-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-378: Missing.
         379-413: LRQFWFQGNRYRKCTDWWCQPMAQLEALWKKMEGV → MEWRKVSECNSVEPCREVKKWPYRCIHHGKNFSRM

    Note: No experimental confirmation available.
    Show »
    Length:127
    Mass (Da):14,936
    Checksum:i5FA0B71723B0564B
    GO
    Isoform 3 (identifier: Q9C0B1-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-445: Missing.
         446-455: QNLRREWHAR → MACQGREECW

    Note: No experimental confirmation available.
    Show »
    Length:60
    Mass (Da):6,924
    Checksum:i54A786243F09AF34
    GO
    Isoform 4 (identifier: Q9C0B1-4) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-399: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:106
    Mass (Da):12,218
    Checksum:iAFE4D8E4F34B2F74
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 13 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    F8WCB8F8WCB8_HUMAN
    Alpha-ketoglutarate-dependent dioxy...
    FTO
    70Annotation score:

    Annotation score:2 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    A0A1B0GTC5A0A1B0GTC5_HUMAN
    Alpha-ketoglutarate-dependent dioxy...
    FTO
    457Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    A0A1B0GTY1A0A1B0GTY1_HUMAN
    Alpha-ketoglutarate-dependent dioxy...
    FTO
    421Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    A0A1B0GTC3A0A1B0GTC3_HUMAN
    Alpha-ketoglutarate-dependent dioxy...
    FTO
    533Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    A0A1B0GUC3A0A1B0GUC3_HUMAN
    Alpha-ketoglutarate-dependent dioxy...
    FTO
    450Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    A0A1B0GTI3A0A1B0GTI3_HUMAN
    Alpha-ketoglutarate-dependent dioxy...
    FTO
    275Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    A0A1B0GU26A0A1B0GU26_HUMAN
    Alpha-ketoglutarate-dependent dioxy...
    FTO
    481Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    A0A1B0GV98A0A1B0GV98_HUMAN
    Alpha-ketoglutarate-dependent dioxy...
    FTO
    455Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    A0A1B0GVH5A0A1B0GVH5_HUMAN
    Alpha-ketoglutarate-dependent dioxy...
    FTO
    559Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    A0A1B0GTZ8A0A1B0GTZ8_HUMAN
    Alpha-ketoglutarate-dependent dioxy...
    FTO
    66Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    There are more potential isoformsShow all

    <p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

    The sequence BAB21843 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti316R → W in BAB21843 (PubMed:11214970).Curated1
    Sequence conflicti316R → W in AAH03583 (PubMed:15489334).Curated1
    Sequence conflicti316R → W in AAH30798 (PubMed:15489334).Curated1
    Sequence conflicti316R → W in AAI32893 (PubMed:15489334).Curated1

    <p>This subsection of the ‘Sequence’ section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement_in_disease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

    Genetic variations at the FTO locus define the body mass index quantitative trait locus 14 (BMIQ14) [MIMi:612460]. Variance in body mass index is a susceptibility factor for obesity.3 Publications

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Natural variantiVAR_076423271H → P Found in a patient with microcephaly, developmental delay, behavioral abnormalities, dysmorphic facial features, hypotonia and other various phenotypic abnormalities; unknown pathological significance. 1 Publication1
    Natural variantiVAR_063252316R → Q in GDFD; has no residual normal activity, impaired ability to demethylate N(6)-methyladenosine RNAs (m6A) RNAs. 2 PublicationsCorresponds to variant dbSNP:rs121918214EnsemblClinVar.1
    Natural variantiVAR_075468319S → F in GDFD; reduced enzyme activity. 1 PublicationCorresponds to variant dbSNP:rs781028867EnsemblClinVar.1
    Natural variantiVAR_075469322R → Q in GDFD. 1 PublicationCorresponds to variant dbSNP:rs745616565Ensembl.1
    Natural variantiVAR_032078405A → V. Corresponds to variant dbSNP:rs16952624Ensembl.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0250021 – 445Missing in isoform 3. 1 PublicationAdd BLAST445
    Alternative sequenceiVSP_0250031 – 399Missing in isoform 4. 1 PublicationAdd BLAST399
    Alternative sequenceiVSP_0250041 – 378Missing in isoform 2. 1 PublicationAdd BLAST378
    Alternative sequenceiVSP_025005379 – 413LRQFW…KMEGV → MEWRKVSECNSVEPCREVKK WPYRCIHHGKNFSRM in isoform 2. 1 PublicationAdd BLAST35
    Alternative sequenceiVSP_025006446 – 455QNLRREWHAR → MACQGREECW in isoform 3. 1 Publication10

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    AB051539 mRNA Translation: BAB21843.1 Different initiation.
    AC007347 Genomic DNA No translation available.
    AC007496 Genomic DNA No translation available.
    AC007909 Genomic DNA No translation available.
    BC003583 mRNA Translation: AAH03583.1
    BC030798 mRNA Translation: AAH30798.1
    BC132892 mRNA Translation: AAI32893.1
    BC137091 mRNA Translation: AAI37092.1

    The Consensus CDS (CCDS) project

    More...
    CCDSi
    CCDS32448.1 [Q9C0B1-1]

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_001073901.1, NM_001080432.2 [Q9C0B1-1]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENST00000431610; ENSP00000415636; ENSG00000140718 [Q9C0B1-4]
    ENST00000460382; ENSP00000417422; ENSG00000140718 [Q9C0B1-4]
    ENST00000463855; ENSP00000417843; ENSG00000140718 [Q9C0B1-2]
    ENST00000471389; ENSP00000418823; ENSG00000140718 [Q9C0B1-1]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    79068

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    hsa:79068

    UCSC genome browser

    More...
    UCSCi
    uc002ehr.4 human [Q9C0B1-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AB051539 mRNA Translation: BAB21843.1 Different initiation.
    AC007347 Genomic DNA No translation available.
    AC007496 Genomic DNA No translation available.
    AC007909 Genomic DNA No translation available.
    BC003583 mRNA Translation: AAH03583.1
    BC030798 mRNA Translation: AAH30798.1
    BC132892 mRNA Translation: AAI32893.1
    BC137091 mRNA Translation: AAI37092.1
    CCDSiCCDS32448.1 [Q9C0B1-1]
    RefSeqiNP_001073901.1, NM_001080432.2 [Q9C0B1-1]

    3D structure databases

    Select the link destinations:
    PDBei
    RCSB PDBi
    PDBji
    Links Updated
    PDB entryMethodResolution (Å)ChainPositionsPDBsum
    3LFMX-ray2.50A32-505[»]
    4CXWX-ray3.10A32-505[»]
    4CXXX-ray2.76A32-505[»]
    4CXYX-ray2.65A32-505[»]
    4IDZX-ray2.46A32-505[»]
    4IE0X-ray2.53A32-505[»]
    4IE4X-ray2.50A32-505[»]
    4IE5X-ray1.95A32-505[»]
    4IE6X-ray2.50A32-505[»]
    4IE7X-ray2.60A32-505[»]
    4QHOX-ray2.37A32-505[»]
    4QKNX-ray2.20A32-503[»]
    4ZS2X-ray2.16A32-505[»]
    4ZS3X-ray2.45A32-505[»]
    5DABX-ray2.10A32-505[»]
    5F8PX-ray2.20A32-502[»]
    SMRiQ9C0B1
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi122520, 29 interactors
    IntActiQ9C0B1, 9 interactors
    STRINGi9606.ENSP00000418823

    Chemistry databases

    BindingDBiQ9C0B1
    ChEMBLiCHEMBL2331065

    PTM databases

    iPTMnetiQ9C0B1
    PhosphoSitePlusiQ9C0B1

    Polymorphism and mutation databases

    BioMutaiFTO
    DMDMi148841515

    Proteomic databases

    EPDiQ9C0B1
    jPOSTiQ9C0B1
    MaxQBiQ9C0B1
    PaxDbiQ9C0B1
    PeptideAtlasiQ9C0B1
    PRIDEiQ9C0B1
    ProteomicsDBi79982
    79983 [Q9C0B1-2]
    79984 [Q9C0B1-3]
    79985 [Q9C0B1-4]

    Protocols and materials databases

    The DNASU plasmid repository

    More...
    DNASUi
    79068
    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000431610; ENSP00000415636; ENSG00000140718 [Q9C0B1-4]
    ENST00000460382; ENSP00000417422; ENSG00000140718 [Q9C0B1-4]
    ENST00000463855; ENSP00000417843; ENSG00000140718 [Q9C0B1-2]
    ENST00000471389; ENSP00000418823; ENSG00000140718 [Q9C0B1-1]
    GeneIDi79068
    KEGGihsa:79068
    UCSCiuc002ehr.4 human [Q9C0B1-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    79068
    DisGeNETi79068

    GeneCards: human genes, protein and diseases

    More...
    GeneCardsi
    FTO

    H-Invitational Database, human transcriptome db

    More...
    H-InvDBi
    HIX0013037
    HIX0134382
    HIX0204005
    HGNCiHGNC:24678 FTO
    HPAiCAB017123
    HPA041086
    HPA068695
    MalaCardsiFTO
    MIMi601665 phenotype
    610966 gene
    612460 phenotype
    612938 phenotype
    neXtProtiNX_Q9C0B1
    OpenTargetsiENSG00000140718
    Orphaneti210144 Lethal polymalformative syndrome, Boissel type
    PharmGKBiPA152208656

    Human Unidentified Gene-Encoded large proteins database

    More...
    HUGEi
    Search...

    GenAtlas: human gene database

    More...
    GenAtlasi
    Search...

    Phylogenomic databases

    eggNOGiENOG410IJ5C Eukaryota
    ENOG4111PKJ LUCA
    GeneTreeiENSGT00390000017730
    HOGENOMiHOG000273870
    InParanoidiQ9C0B1
    KOiK19469
    OrthoDBi1300974at2759
    PhylomeDBiQ9C0B1
    TreeFamiTF333296

    Enzyme and pathway databases

    ReactomeiR-HSA-73943 Reversal of alkylation damage by DNA dioxygenases

    Miscellaneous databases

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...
    ChiTaRSi
    FTO human

    The Gene Wiki collection of pages on human genes and proteins

    More...
    GeneWikii
    FTO_gene

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...
    GenomeRNAii
    79068

    Protein Ontology

    More...
    PROi
    PR:Q9C0B1

    The Stanford Online Universal Resource for Clones and ESTs

    More...
    SOURCEi
    Search...

    Gene expression databases

    BgeeiENSG00000140718 Expressed in 236 organ(s), highest expression level in forebrain
    ExpressionAtlasiQ9C0B1 baseline and differential
    GenevisibleiQ9C0B1 HS

    Family and domain databases

    Gene3Di1.20.58.1470, 1 hit
    2.60.120.590, 1 hit
    InterProiView protein in InterPro
    IPR037151 AlkB-like_sf
    IPR032868 FTO
    IPR024366 FTO_C
    IPR038413 FTO_C_sf
    IPR024367 FTO_cat_dom
    PANTHERiPTHR31291 PTHR31291, 1 hit
    PfamiView protein in Pfam
    PF12934 FTO_CTD, 1 hit
    PF12933 FTO_NTD, 1 hit
    SMARTiView protein in SMART
    SM01223 FTO_NTD, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFTO_HUMAN
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9C0B1
    Secondary accession number(s): A2RUH1
    , B2RNS0, Q0P676, Q7Z785
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 2007
    Last sequence update: May 29, 2007
    Last modified: May 8, 2019
    This is version 128 of the entry and version 3 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 16
      Human chromosome 16: entries, gene names and cross-references to MIM
    2. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    3. SIMILARITY comments
      Index of protein domains and families
    4. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    5. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    6. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again