Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 129 (17 Jun 2020)
Sequence version 2 (21 Aug 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Sperm flagellar protein 2

Gene

SPEF2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for correct axoneme development in spermatozoa. Important for normal development of the manchette and sperm head morphology. Essential for male fertility. Plays a role in localization of the intraflagellar transport protein IFT20 to the manchette, suggesting function as an adapter for dynein-mediated protein transport during spermatogenesis. Also plays a role in bone growth where it seems to be required for normal osteoblast differentiation.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processDifferentiation, Spermatogenesis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sperm flagellar protein 2
Alternative name(s):
Protein KPL2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SPEF2
Synonyms:KIAA1770, KPL2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000152582.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26293 SPEF2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610172 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9C093

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Golgi apparatus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
79925

MalaCards human disease database

More...
MalaCardsi
SPEF2

Open Targets

More...
OpenTargetsi
ENSG00000152582

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
276234 Non-syndromic male infertility due to sperm motility disorder
244 Primary ciliary dyskinesia

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162404451

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9C093 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SPEF2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
156630941

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002990291 – 1822Sperm flagellar protein 2Add BLAST1822

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9C093

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9C093

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9C093

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9C093

PeptideAtlas

More...
PeptideAtlasi
Q9C093

PRoteomics IDEntifications database

More...
PRIDEi
Q9C093

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
79968 [Q9C093-1]
79969 [Q9C093-2]
79970 [Q9C093-3]
79971 [Q9C093-4]

PTM databases

CarbonylDB database of protein carbonylation sites

More...
CarbonylDBi
Q9C093

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9C093

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9C093

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000152582 Expressed in right uterine tube and 126 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9C093 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9C093 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000152582 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via C-terminus) with IFT20 (PubMed:19889948).

Interacts with DYNC1I2 (By similarity).

By similarity1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
123002, 3 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9C093

Protein interaction database and analysis system

More...
IntActi
Q9C093, 8 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000348314

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9C093 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 105Calponin-homology (CH)PROSITE-ProRule annotationAdd BLAST105

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1324 – 1676Interaction with IFT201 PublicationAdd BLAST353

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili227 – 260Sequence analysisAdd BLAST34
Coiled coili321 – 396Sequence analysisAdd BLAST76
Coiled coili732 – 758Sequence analysisAdd BLAST27
Coiled coili871 – 909Sequence analysisAdd BLAST39
Coiled coili1686 – 1712Sequence analysisAdd BLAST27

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IEY9 Eukaryota
ENOG410XS1Z LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000008160

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_015066_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9C093

Identification of Orthologs from Complete Genome Data

More...
OMAi
ALPWPIP

Database of Orthologous Groups

More...
OrthoDBi
81320at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9C093

TreeFam database of animal gene trees

More...
TreeFami
TF329522

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.418.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001715 CH-domain
IPR010441 CH_2
IPR036872 CH_dom_sf
IPR011992 EF-hand-dom_pair
IPR027417 P-loop_NTPase

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06294 CH_2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47473 SSF47473, 1 hit
SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50021 CH, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9C093-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSEILCQWLN KELKVSRTVS PKSFAKAFSS GYLLGEVLHK FELQDDFSEF
60 70 80 90 100
LDSRVSSAKL NNFSRLEPTL NLLGVQFDQN VAHGIITEKP GVATKLLYQL
110 120 130 140 150
YIALQKKKKS GLTGVEMQTM QRLTNLRLQN MKSDTFQERL RHMIPRQTDF
160 170 180 190 200
NLMRITYRFQ EKYKHVKEDL AHLHFEKLER FQKLKEEQRC FDIEKQYLNR
210 220 230 240 250
RRQNEIMAKI QAAIIQIPKP ASNRTLKALE AQKMMKKKKE AEDVADEIKK
260 270 280 290 300
FEALIKKDLQ AKESASKTSL DTAGQTTTDL LNTYSDDEYI KKIQKRLEED
310 320 330 340 350
AFAREQREKR RRKLLMDQLI AHEAQEEAYR EEQLINRLMR QSQQERRIAV
360 370 380 390 400
QLMHVRHEKE VLWQNRIFRE KQHEERRLKD FQDALDREAA LAKQAKIDFE
410 420 430 440 450
EQFLKEKRFH DQIAVERAQA RYEKHYSVCA EILDQIVDLS TKVADYRMLT
460 470 480 490 500
NNLIPYKLMH DWKELFFNAK PIYEQASVKT LPANPSREQL TELEKRDLLD
510 520 530 540 550
TNDYEEYKNM VGEWALPEEM VDNLPPSNNC ILGHILHRLA EKSLPPRAES
560 570 580 590 600
TTPELPSFAV KGCLLGKTLS GKTTILRSLQ KDFPIQILSI DTLVQEAIQA
610 620 630 640 650
FHDNEKVSEV LPIQKNDEED ALPVLQEEIK ESQDPQHVFS AGPVSDEVLP
660 670 680 690 700
ETEGETMLSA NADKTPKAEE VKSSDSFLKL TTRAQLGAKS EQLLKKGKSI
710 720 730 740 750
PDVLLVDIIV NAINEIPVNQ DCILDGFPMT LNQAQLLEEA LTGCNRNLTE
760 770 780 790 800
VERKKAQKST LAIDPATSKE IPLPSPAFDF VILLDVSDTS SMSRMNDIIA
810 820 830 840 850
EELSYKTAHE DISQRVAAEN QDKDGDQNLR DQIQHRIIGF LDNWPLLEQW
860 870 880 890 900
FSEPENILIK INAEIDKESL CEKVKEILTT EIAKKKNKVE KKLEEKEAEK
910 920 930 940 950
KAAASLAELP LPTPPPAPPP EPEKEKEIHQ SHVASKTPTA KGKPQSEAPH
960 970 980 990 1000
GKQESLQEGK GKKGETALKR KGSPKGKSSG GKVPVKKSPA DSTDTSPVAI
1010 1020 1030 1040 1050
VPQPPKPGSE EWVYVNEPVP EEMPLFLVPY WELIENSYIN TIKTVLRHLR
1060 1070 1080 1090 1100
EDQHTVLAYL YEIRTSFQEF LKRPDHKQDF VAQWQADFNS LPDDLWDDEE
1110 1120 1130 1140 1150
TKAELHQRVN DLRDRLWDIC DARKEEAEQE RLDIINESWL QDTLGMTMNH
1160 1170 1180 1190 1200
FFSLMQAELN RFQDTKRLLQ DYYWGMESKI PVEDNKRFTR IPLVQLDSKD
1210 1220 1230 1240 1250
NSESQLRIPL VPRISISLET VTPKPKTKSV LKGKMDNSLE NVESNFEADE
1260 1270 1280 1290 1300
KLVMDTWQQA SLAVSHMVAA EIHQRLMEEE KENQPADPKE KSPQMGANKK
1310 1320 1330 1340 1350
VKKEPPKKKQ EDKKPKGKSP PMAEATPVIV TTEEIAEIKR KNELRVKIKE
1360 1370 1380 1390 1400
EHLAALQFEE IATQFRLELI KTKALALLED LVTKVVDVYK LMEKWLGERY
1410 1420 1430 1440 1450
LNEMASTEKL TDVARYHIET STKIQNELYL SQEDFFINGN IKVFPDPPPS
1460 1470 1480 1490 1500
IRPPPVEKEE DGTLTIEQLD SLRDQFLDMA PKGIIGNKAF TDILIDLVTL
1510 1520 1530 1540 1550
NLGTNNFPSN WMHLTQPELQ ELTSLLTVNS EFVDWRKFLL VTSMPWPIPL
1560 1570 1580 1590 1600
EEELLETLQK FKAVDKEQLG TITFEQYMQA GLWFTGDEDI KIPENPLEPL
1610 1620 1630 1640 1650
PFNRQEHLIE FFFRLFADYE KDPPQLDYTQ MLLYFACHPD TVEGVYRALS
1660 1670 1680 1690 1700
VAVGTHVFQQ VKASIPSAEK TSSTDAGPAE EFPEPEENAA REERKLKDDT
1710 1720 1730 1740 1750
EKREQKDEEI PENANNEKMS METLLKVFKG GSEAQDSNRF ASHLKIENIY
1760 1770 1780 1790 1800
AEGFIKTFQD LGAKNLEPIE VAVLLKHPFI QDLISNYSDY KFPDIKIILQ
1810 1820
RSEHVQGSDG ERSPSRHTEE KK
Length:1,822
Mass (Da):209,811
Last modified:August 21, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i88D4FC856DBC3FE4
GO
Isoform 2 (identifier: Q9C093-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     655-659: Missing.
     1794-1822: DIKIILQRSEHVQGSDGERSPSRHTEEKK → VHIIYVVEMIVCAKGWAPLPSGKQCARWRN

Show »
Length:1,818
Mass (Da):209,315
Checksum:i67BE9FB7633FF2AE
GO
Isoform 3 (identifier: Q9C093-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     509-514: NMVGEW → VPTDMK
     515-1822: Missing.

Show »
Length:514
Mass (Da):61,158
Checksum:i1EDCBBB7B579D79C
GO
Isoform 4 (identifier: Q9C093-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1483: MSEILCQWLN...DQFLDMAPKG → MPSQIGDRKW...HMHAKIKAES

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:619
Mass (Da):70,801
Checksum:i6D539729BBC266AF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6REZ4D6REZ4_HUMAN
Sperm flagellar protein 2
SPEF2
943Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GWD8A0A1B0GWD8_HUMAN
Sperm flagellar protein 2
SPEF2
2,169Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RGZ5D6RGZ5_HUMAN
Sperm flagellar protein 2
SPEF2
240Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y989H0Y989_HUMAN
Sperm flagellar protein 2
SPEF2
115Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YAC0H0YAC0_HUMAN
Sperm flagellar protein 2
SPEF2
151Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y8H6H0Y8H6_HUMAN
Sperm flagellar protein 2
SPEF2
115Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GWC1A0A1B0GWC1_HUMAN
Sperm flagellar protein 2
SPEF2
174Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB15700 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1698D → G in BAB15563 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03476671N → H1 PublicationCorresponds to variant dbSNP:rs6897513EnsemblClinVar.1
Natural variantiVAR_03476774G → S. Corresponds to variant dbSNP:rs34307272Ensembl.1
Natural variantiVAR_034768366R → K. Corresponds to variant dbSNP:rs16902381Ensembl.1
Natural variantiVAR_034769447R → Q. Corresponds to variant dbSNP:rs34852821Ensembl.1
Natural variantiVAR_034770500D → N1 PublicationCorresponds to variant dbSNP:rs34708521EnsemblClinVar.1
Natural variantiVAR_034771616N → K. Corresponds to variant dbSNP:rs7710284EnsemblClinVar.1
Natural variantiVAR_034772655E → G. Corresponds to variant dbSNP:rs12332369Ensembl.1
Natural variantiVAR_051376904A → V1 PublicationCorresponds to variant dbSNP:rs13170082EnsemblClinVar.1
Natural variantiVAR_051377934A → P1 PublicationCorresponds to variant dbSNP:rs13170390EnsemblClinVar.1
Natural variantiVAR_0347731482K → N. Corresponds to variant dbSNP:rs2277044Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0275211 – 1483MSEIL…MAPKG → MPSQIGDRKWLHGLQAALQN FLKGYPAIVRQLHSAGRGKS DTSQKKPKELLESLLQADIV KFAHFLLDVMNVLSILSCVN KNRNSSIADIFATLESMLEM LQMYQTRLGPKERMVDSATH FHGNCLRGKENISAVRNIVL THLIKRLQGCFRDASQNVVR ATVIGSFKLWPTKINQEFGE KEVSILTAHYEPVLEAANVK LSEVDTEWSMLKLEIYARFQ NIRKLTWDFVNSIYLHKYPN ILTLVDLVLTLPASSAEAEH GFSQMKWTKSHMHAKIKAES in isoform 4. 1 PublicationAdd BLAST1483
Alternative sequenceiVSP_027522509 – 514NMVGEW → VPTDMK in isoform 3. 2 Publications6
Alternative sequenceiVSP_027523515 – 1822Missing in isoform 3. 2 PublicationsAdd BLAST1308
Alternative sequenceiVSP_027524655 – 659Missing in isoform 2. 1 Publication5
Alternative sequenceiVSP_0275251794 – 1822DIKII…TEEKK → VHIIYVVEMIVCAKGWAPLP SGKQCARWRN in isoform 2. 1 PublicationAdd BLAST29

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK026817 mRNA Translation: BAB15563.1
AK027230 mRNA Translation: BAB15700.1 Different initiation.
AK058124 mRNA Translation: BAB71674.1
BC110984 mRNA Translation: AAI10985.1
AB051557 mRNA Translation: BAB21861.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3910.1 [Q9C093-3]
CCDS43309.1 [Q9C093-1]

NCBI Reference Sequences

More...
RefSeqi
NP_079143.3, NM_024867.3 [Q9C093-1]
NP_653323.1, NM_144722.3 [Q9C093-3]
XP_005248434.1, XM_005248377.3 [Q9C093-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000282469; ENSP00000282469; ENSG00000152582 [Q9C093-3]
ENST00000356031; ENSP00000348314; ENSG00000152582 [Q9C093-1]
ENST00000440995; ENSP00000412125; ENSG00000152582 [Q9C093-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79925

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79925

UCSC genome browser

More...
UCSCi
uc003jjn.2 human [Q9C093-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK026817 mRNA Translation: BAB15563.1
AK027230 mRNA Translation: BAB15700.1 Different initiation.
AK058124 mRNA Translation: BAB71674.1
BC110984 mRNA Translation: AAI10985.1
AB051557 mRNA Translation: BAB21861.1
CCDSiCCDS3910.1 [Q9C093-3]
CCDS43309.1 [Q9C093-1]
RefSeqiNP_079143.3, NM_024867.3 [Q9C093-1]
NP_653323.1, NM_144722.3 [Q9C093-3]
XP_005248434.1, XM_005248377.3 [Q9C093-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi123002, 3 interactors
CORUMiQ9C093
IntActiQ9C093, 8 interactors
STRINGi9606.ENSP00000348314

PTM databases

CarbonylDBiQ9C093
iPTMnetiQ9C093
PhosphoSitePlusiQ9C093

Polymorphism and mutation databases

BioMutaiSPEF2
DMDMi156630941

Proteomic databases

EPDiQ9C093
jPOSTiQ9C093
MassIVEiQ9C093
PaxDbiQ9C093
PeptideAtlasiQ9C093
PRIDEiQ9C093
ProteomicsDBi79968 [Q9C093-1]
79969 [Q9C093-2]
79970 [Q9C093-3]
79971 [Q9C093-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
22874 43 antibodies

The DNASU plasmid repository

More...
DNASUi
79925

Genome annotation databases

EnsembliENST00000282469; ENSP00000282469; ENSG00000152582 [Q9C093-3]
ENST00000356031; ENSP00000348314; ENSG00000152582 [Q9C093-1]
ENST00000440995; ENSP00000412125; ENSG00000152582 [Q9C093-2]
GeneIDi79925
KEGGihsa:79925
UCSCiuc003jjn.2 human [Q9C093-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79925
DisGeNETi79925
EuPathDBiHostDB:ENSG00000152582.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SPEF2
HGNCiHGNC:26293 SPEF2
HPAiENSG00000152582 Low tissue specificity
MalaCardsiSPEF2
MIMi610172 gene
neXtProtiNX_Q9C093
OpenTargetsiENSG00000152582
Orphaneti276234 Non-syndromic male infertility due to sperm motility disorder
244 Primary ciliary dyskinesia
PharmGKBiPA162404451

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IEY9 Eukaryota
ENOG410XS1Z LUCA
GeneTreeiENSGT00390000008160
HOGENOMiCLU_015066_0_0_1
InParanoidiQ9C093
OMAiALPWPIP
OrthoDBi81320at2759
PhylomeDBiQ9C093
TreeFamiTF329522

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
79925 11 hits in 780 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SPEF2 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SPEF2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79925
PharosiQ9C093 Tdark

Protein Ontology

More...
PROi
PR:Q9C093
RNActiQ9C093 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000152582 Expressed in right uterine tube and 126 other tissues
ExpressionAtlasiQ9C093 baseline and differential
GenevisibleiQ9C093 HS

Family and domain databases

Gene3Di1.10.418.10, 1 hit
InterProiView protein in InterPro
IPR001715 CH-domain
IPR010441 CH_2
IPR036872 CH_dom_sf
IPR011992 EF-hand-dom_pair
IPR027417 P-loop_NTPase
PfamiView protein in Pfam
PF06294 CH_2, 1 hit
SUPFAMiSSF47473 SSF47473, 1 hit
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50021 CH, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSPEF2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9C093
Secondary accession number(s): Q2TAC9
, Q96LL6, Q9H5C7, Q9H5Q7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 21, 2007
Last sequence update: August 21, 2007
Last modified: June 17, 2020
This is version 129 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again