Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein phosphatase 1 regulatory subunit 12C

Gene

PPP1R12C

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulates myosin phosphatase activity.1 Publication

Caution

Although assigned as two separate genes (PPP1R12C and LENG3), it is probable that LENG3 does not exist by itself and is a part of the PPP1R12C gene.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • enzyme inhibitor activity Source: GO_Central
  • phosphatase regulator activity Source: GO_Central
  • protein kinase binding Source: InterPro

GO - Biological processi

Enzyme and pathway databases

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9BZL4

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein phosphatase 1 regulatory subunit 12C
Alternative name(s):
Protein phosphatase 1 myosin-binding subunit of 85 kDa
Short name:
Protein phosphatase 1 myosin-binding subunit p85
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PPP1R12CImported
Synonyms:LENG3, MBS851 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000125503.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14947 PPP1R12C

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
613245 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BZL4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
54776

Open Targets

More...
OpenTargetsi
ENSG00000125503

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA33619

Polymorphism and mutation databases

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74752476

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003158632 – 782Protein phosphatase 1 regulatory subunit 12CAdd BLAST781

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineCombined sources1
Modified residuei399PhosphoserineCombined sources1
Modified residuei407PhosphoserineCombined sources1
Modified residuei427PhosphoserineCombined sources1
Modified residuei452PhosphoserineCombined sources1
Modified residuei509PhosphoserineCombined sources1
Modified residuei560Phosphothreonine; by CDC42BP and ROCK2Combined sources1 Publication1
Modified residuei604PhosphoserineCombined sources1
Modified residuei647PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation at Thr-560 is essential for its interaction with PPP1CB.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9BZL4

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9BZL4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BZL4

PeptideAtlas

More...
PeptideAtlasi
Q9BZL4

PRoteomics IDEntifications database

More...
PRIDEi
Q9BZL4

ProteomicsDB human proteome resource

More...
ProteomicsDBi
79868
79869 [Q9BZL4-2]
79870 [Q9BZL4-3]
79871 [Q9BZL4-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BZL4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BZL4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed. Highly expressed in heart.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000125503 Expressed in 199 organ(s), highest expression level in lower esophagus muscularis layer

CleanEx database of gene expression profiles

More...
CleanExi
HS_PPP1R12C

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9BZL4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BZL4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA043532

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

PP1 comprises a catalytic subunit, PPP1CA, PPP1CB or PPP1CC, and one or several targeting or regulatory subunits. PPP1R12C mediates binding to myosin. Interacts via its N-terminus with PPP1CB. Interacts with IL16. Interacts with the coiled-coil domain of MPRIP. Interacts with NOD2 (PubMed:27812135).3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120144, 17 interactors

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q9BZL4

Protein interaction database and analysis system

More...
IntActi
Q9BZL4, 25 interactors

Molecular INTeraction database

More...
MINTi
Q9BZL4

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000263433

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9BZL4

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9BZL4

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati100 – 129ANK 1Sequence analysisAdd BLAST30
Repeati133 – 162ANK 2Sequence analysisAdd BLAST30
Repeati226 – 255ANK 3Sequence analysisAdd BLAST30
Repeati259 – 288ANK 4Sequence analysisAdd BLAST30

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili297 – 329Sequence analysisAdd BLAST33
Coiled coili681 – 782Sequence analysisAdd BLAST102

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi473 – 523Pro-richSequence analysisAdd BLAST51

Keywords - Domaini

ANK repeat, Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0505 Eukaryota
COG0666 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161425

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000290648

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG104929

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BZL4

KEGG Orthology (KO)

More...
KOi
K17457

Identification of Orthologs from Complete Genome Data

More...
OMAi
NSEGPAQ

Database of Orthologous Groups

More...
OrthoDBi
EOG091G06U5

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BZL4

TreeFam database of animal gene trees

More...
TreeFami
TF105543

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00204 ANK, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.20, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR017401 MYPT1/MYPT2/Mbs85
IPR031205 PPP1R12C
IPR031775 PRKG1_interact

The PANTHER Classification System

More...
PANTHERi
PTHR24179:SF27 PTHR24179:SF27, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12796 Ank_2, 2 hits
PF15898 PRKG1_interact, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF038141 PP1_12ABC_vert, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01415 ANKYRIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00248 ANK, 4 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48403 SSF48403, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 13 Publications (identifier: Q9BZL4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSGEDGPAAG PGAAAAAARE RRREQLRQWG ARAGAEPGPG ERRARTVRFE
60 70 80 90 100
RAAEFLAACA GGDLDEARLM LRAADPGPGA ELDPAAPPPA RAVLDSTNAD
110 120 130 140 150
GISALHQACI DENLEVVRFL VEQGATVNQA DNEGWTPLHV AASCGYLDIA
160 170 180 190 200
RYLLSHGANI AAVNSDGDLP LDLAESDAME GLLKAEIARR GVDVEAAKRA
210 220 230 240 250
EEELLLHDTR CWLNGGAMPE ARHPRTGASA LHVAAAKGYI EVMRLLLQAG
260 270 280 290 300
YDPELRDGDG WTPLHAAAHW GVEDACRLLA EHGGGMDSLT HAGQRPCDLA
310 320 330 340 350
DEEVLSLLEE LARKQEDLRN QKEASQSRGQ EPQAPSSSKH RRSSVCRLSS
360 370 380 390 400
REKISLQDLS KERRPGGAGG PPIQDEDEGE EGPTEPPPAE PRTLNGVSSP
410 420 430 440 450
PHPSPKSPVQ LEEAPFSRRF GLLKTGSSGA LGPPERRTAE GAPGAGLQRS
460 470 480 490 500
ASSSWLEGTS TQAKELRLAR ITPTPSPKLP EPSVLSEVTK PPPCLENSSP
510 520 530 540 550
PSRIPEPESP AKPNVPTAST APPADSRDRR RSYQMPVRDE ESESQRKARS
560 570 580 590 600
RLMRQSRRST QGVTLTDLKE AEKAAGKAPE SEKPAQSLDP SRRPRVPGVE
610 620 630 640 650
NSDSPAQRAE APDGQGPGPQ AAREHRKVGK EWRGPAEGEE AEPADRSQES
660 670 680 690 700
STLEGGPSAR RQRWQRDLNP EPEPESEEPD GGFRTLYAEL RRENERLREA
710 720 730 740 750
LTETTLRLAQ LKVELERATQ RQERFAERPA LLELERFERR ALERKAAELE
760 770 780
EELKALSDLR ADNQRLKDEN AALIRVISKL SK
Length:782
Mass (Da):84,881
Last modified:June 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i677E7EB1B62C2CC8
GO
Isoform 21 Publication (identifier: Q9BZL4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     576-638: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:719
Mass (Da):78,234
Checksum:i6E800246823EC0C4
GO
Isoform 3 (identifier: Q9BZL4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     410-410: Missing.
     609-609: Missing.

Note: No experimental confirmation available.
Show »
Length:780
Mass (Da):84,682
Checksum:iCD10D87B6E68FE49
GO
Isoform 4 (identifier: Q9BZL4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     609-609: Missing.

Note: No experimental confirmation available.
Show »
Length:781
Mass (Da):84,810
Checksum:iEE25D3C5CF1E4D6F
GO
Isoform 5 (identifier: Q9BZL4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MSGEDGPAAGPGAAAAAARERRREQLRQWGAR → MRNGGPCQPLAAGPRAEGASVNWSVTAWGPGT
     33-106: Missing.
     609-609: Missing.

Note: No experimental confirmation available.
Show »
Length:707
Mass (Da):77,169
Checksum:i991C11608AB2807F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EL81K7EL81_HUMAN
Protein phosphatase 1 regulatory su...
PPP1R12C
737Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ER83K7ER83_HUMAN
Protein phosphatase 1 regulatory su...
PPP1R12C
234Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AF211968 differs from that shown. Unspliced mRNA.Curated
The sequence BAB15651 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC85179 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti438T → I in AAH08030 (PubMed:15489334).Curated1
Sequence conflicti527R → W in BAB15651 (PubMed:14702039).Curated1
Sequence conflicti537V → A in BAC85179 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_048310419R → C. Corresponds to variant dbSNP:rs35849605Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0572161 – 32MSGED…QWGAR → MRNGGPCQPLAAGPRAEGAS VNWSVTAWGPGT in isoform 5. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_05721733 – 106Missing in isoform 5. 1 PublicationAdd BLAST74
Alternative sequenceiVSP_030750410Missing in isoform 3. 2 Publications1
Alternative sequenceiVSP_052643576 – 638Missing in isoform 2. 1 PublicationAdd BLAST63
Alternative sequenceiVSP_030751609Missing in isoform 3, isoform 4 and isoform 5. 3 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF312028 mRNA Translation: AAG60045.1
AB209452 mRNA Translation: BAD92689.1
AK129529 mRNA Translation: BAC85179.1 Different initiation.
AK297426 mRNA Translation: BAG59854.1
AK027086 mRNA Translation: BAB15651.1 Different initiation.
AC005782 Genomic DNA No translation available.
AC010327 Genomic DNA No translation available.
AF211968 mRNA No translation available.
AL137618 mRNA Translation: CAB70844.1
BC008030 mRNA Translation: AAH08030.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS12916.1 [Q9BZL4-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
T46318

NCBI Reference Sequences

More...
RefSeqi
NP_001258547.1, NM_001271618.1 [Q9BZL4-3]
NP_060077.1, NM_017607.3 [Q9BZL4-1]
XP_005259070.1, XM_005259013.3 [Q9BZL4-4]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.631579

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000263433; ENSP00000263433; ENSG00000125503 [Q9BZL4-1]
ENST00000435544; ENSP00000387833; ENSG00000125503 [Q9BZL4-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
54776

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:54776

UCSC genome browser

More...
UCSCi
uc002qix.5 human [Q9BZL4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF312028 mRNA Translation: AAG60045.1
AB209452 mRNA Translation: BAD92689.1
AK129529 mRNA Translation: BAC85179.1 Different initiation.
AK297426 mRNA Translation: BAG59854.1
AK027086 mRNA Translation: BAB15651.1 Different initiation.
AC005782 Genomic DNA No translation available.
AC010327 Genomic DNA No translation available.
AF211968 mRNA No translation available.
AL137618 mRNA Translation: CAB70844.1
BC008030 mRNA Translation: AAH08030.1
CCDSiCCDS12916.1 [Q9BZL4-1]
PIRiT46318
RefSeqiNP_001258547.1, NM_001271618.1 [Q9BZL4-3]
NP_060077.1, NM_017607.3 [Q9BZL4-1]
XP_005259070.1, XM_005259013.3 [Q9BZL4-4]
UniGeneiHs.631579

3D structure databases

ProteinModelPortaliQ9BZL4
SMRiQ9BZL4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120144, 17 interactors
ELMiQ9BZL4
IntActiQ9BZL4, 25 interactors
MINTiQ9BZL4
STRINGi9606.ENSP00000263433

PTM databases

iPTMnetiQ9BZL4
PhosphoSitePlusiQ9BZL4

Polymorphism and mutation databases

DMDMi74752476

Proteomic databases

EPDiQ9BZL4
MaxQBiQ9BZL4
PaxDbiQ9BZL4
PeptideAtlasiQ9BZL4
PRIDEiQ9BZL4
ProteomicsDBi79868
79869 [Q9BZL4-2]
79870 [Q9BZL4-3]
79871 [Q9BZL4-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
54776
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000263433; ENSP00000263433; ENSG00000125503 [Q9BZL4-1]
ENST00000435544; ENSP00000387833; ENSG00000125503 [Q9BZL4-5]
GeneIDi54776
KEGGihsa:54776
UCSCiuc002qix.5 human [Q9BZL4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
54776
DisGeNETi54776
EuPathDBiHostDB:ENSG00000125503.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PPP1R12C
HGNCiHGNC:14947 PPP1R12C
HPAiHPA043532
MIMi613245 gene
neXtProtiNX_Q9BZL4
OpenTargetsiENSG00000125503
PharmGKBiPA33619

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0505 Eukaryota
COG0666 LUCA
GeneTreeiENSGT00940000161425
HOGENOMiHOG000290648
HOVERGENiHBG104929
InParanoidiQ9BZL4
KOiK17457
OMAiNSEGPAQ
OrthoDBiEOG091G06U5
PhylomeDBiQ9BZL4
TreeFamiTF105543

Enzyme and pathway databases

SIGNORiQ9BZL4

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
54776

Protein Ontology

More...
PROi
PR:Q9BZL4

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000125503 Expressed in 199 organ(s), highest expression level in lower esophagus muscularis layer
CleanExiHS_PPP1R12C
ExpressionAtlasiQ9BZL4 baseline and differential
GenevisibleiQ9BZL4 HS

Family and domain databases

CDDicd00204 ANK, 1 hit
Gene3Di1.25.40.20, 2 hits
InterProiView protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR017401 MYPT1/MYPT2/Mbs85
IPR031205 PPP1R12C
IPR031775 PRKG1_interact
PANTHERiPTHR24179:SF27 PTHR24179:SF27, 1 hit
PfamiView protein in Pfam
PF12796 Ank_2, 2 hits
PF15898 PRKG1_interact, 1 hit
PIRSFiPIRSF038141 PP1_12ABC_vert, 1 hit
PRINTSiPR01415 ANKYRIN
SMARTiView protein in SMART
SM00248 ANK, 4 hits
SUPFAMiSSF48403 SSF48403, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 4 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPP12C_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BZL4
Secondary accession number(s): B4DME2
, Q59FK8, Q6ZPD1, Q7L8F7, Q96HW1, Q9H5H5, Q9NT00
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: June 1, 2001
Last modified: December 5, 2018
This is version 139 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again