Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9BZF3 (OSBL6_HUMAN)

Entry version 164 (02 Dec 2020)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Add a publicationFeedback
Protein

Oxysterol-binding protein-related protein 6

Gene

OSBPL6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulates cellular transport and efflux of cholesterol (PubMed:26941018). Plays a role in phosphatidylinositol-4-phophate (PI4P) turnover at the neuronal membrane (By similarity). Binds via its PH domain PI4P, phosphatidylinositol-4,5-diphosphate, phosphatidylinositol-3,4,5-triphosphate, and phosphatidic acid (By similarity). Weakly binds 25-hydroxycholesterol (PubMed:17428193).By similarity2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processLipid transport, Transport
LigandLipid-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9BZF3

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-192105, Synthesis of bile acids and bile salts

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Oxysterol-binding protein-related protein 6
Short name:
ORP-6
Short name:
OSBP-related protein 6
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:OSBPL6
Synonyms:ORP6
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000079156.16

Human Gene Nomenclature Database

More...HGNCi		HGNC:16388, OSBPL6

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		606734, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9BZF3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Endoplasmic reticulum, Endosome, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		114880

Open Targets

More...OpenTargetsi		ENSG00000079156

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA32830

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9BZF3, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		OSBPL6

Domain mapping of disease mutations (DMDM)

More...DMDMi		20139133

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001003752 – 934Oxysterol-binding protein-related protein 6Add BLAST933

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineCombined sources1
Modified residuei35PhosphoserineCombined sources1
Modified residuei190PhosphoserineCombined sources1
Modified residuei290PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9BZF3

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9BZF3

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9BZF3

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9BZF3

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9BZF3

PeptideAtlas

More...PeptideAtlasi		Q9BZF3

PRoteomics IDEntifications database

More...PRIDEi		Q9BZF3

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		69974
79831 [Q9BZF3-1]
79832 [Q9BZF3-2]
79833 [Q9BZF3-3]
79834 [Q9BZF3-4]
79835 [Q9BZF3-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9BZF3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9BZF3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain and striated muscle (at protein level) (PubMed:14593528). Widely expressed (PubMed:11735225). Expressed in skeletal muscle (PubMed:14593528).

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in fetal brain and lung.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By acetylated low-density lipoprotein.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000079156, Expressed in bronchial epithelial cell and 199 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9BZF3, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000079156, Tissue enhanced (skeletal)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer (By similarity).

Interacts with OSBPL3 (By similarity).

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		125381, 53 interactors

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		Q9BZF3

Protein interaction database and analysis system

More...IntActi		Q9BZF3, 27 interactors

Molecular INTeraction database

More...MINTi		Q9BZF3

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000376293

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9BZF3, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9BZF3

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini86 – 181PHPROSITE-ProRule annotationAdd BLAST96

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the OSBP family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1737, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000156791

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_007105_4_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9BZF3

Identification of Orthologs from Complete Genome Data

More...OMAi		SESIICE

Database of Orthologous Groups

More...OrthoDBi		542090at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9BZF3

TreeFam database of animal gene trees

More...TreeFami		TF320922

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR037239, OSBP_sf
IPR000648, Oxysterol-bd
IPR018494, Oxysterol-bd_CS
IPR011993, PH-like_dom_sf
IPR041680, PH_8
IPR001849, PH_domain

The PANTHER Classification System

More...PANTHERi		PTHR10972, PTHR10972, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01237, Oxysterol_BP, 1 hit
PF15409, PH_8, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00233, PH, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF144000, SSF144000, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS01013, OSBP, 1 hit
PS50003, PH_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9BZF3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSDEKGISP AHKTSTPTHR SASSSTSSQR DSRQSIHILE RTASSSTEPS 
        60         70         80         90        100
VSRQLLEPEP VPLSKEADSW EIIEGLKIGQ TNVQKPDKHE GFMLKKRKWP 
       110        120        130        140        150
LKGWHKRFFV LDNGMLKYSK APLDIQKGKV HGSIDVGLSV MSIKKKARRI 
       160        170        180        190        200
DLDTEEHIYH LKVKSQDWFD AWVSKLRHHR LYRQNEIVRS PRDASFHIFP 
       210        220        230        240        250
STSTAESSPA ANVSVMDGKM QPNSFPWQSP LPCSNSLPAT CTTGQSKVAA 
       260        270        280        290        300
WLQDSEEMDR CAEDLAHCQS NLVELSKLLQ NLEILQRTQS APNFTDMQAN 
       310        320        330        340        350
CVDISKKDKR VTRRWRTKSV SKDTKIQLQV PFSATMSPVR LHSSNPNLCA 
       360        370        380        390        400
DIEFQTPPSH LTDPLESSTD YTKLQEEFCL IAQKVHSLLK SAFNSIAIEK 
       410        420        430        440        450
EKLKQMVSEQ DHSKGHSTQM ARLRQSLSQA LNQNAELRSR LNRIHSESII 
       460        470        480        490        500
CDQVVSVNII PSPDEAGEQI HVSLPLSQQV ANESRLSMSE SVSEFFDAQE 
       510        520        530        540        550
VLLSASSSEN EASDDESYIS DVSDNISEDN TSVADNISRQ ILNGELTGGA 
       560        570        580        590        600
FRNGRRACLP APCPDTSNIN LWNILRNNIG KDLSKVSMPV ELNEPLNTLQ 
       610        620        630        640        650
HLCEEMEYSE LLDKASETDD PYERMVLVAA FAVSGYCSTY FRAGSKPFNP 
       660        670        680        690        700
VLGETYECIR EDKGFRFFSE QVSHHPPISA CHCESKNFVF WQDIRWKNKF 
       710        720        730        740        750
WGKSMEILPV GTLNVMLPKY GDYYVWNKVT TCIHNILSGR RWIEHYGEVT 
       760        770        780        790        800
IRNTKSSVCI CKLTFVKVNY WNSNMNEVQG VVIDQEGKAV YRLFGKWHEG 
       810        820        830        840        850
LYCGVAPSAK CIWRPGSMPT NYELYYGFTR FAIELNELDP VLKDLLPPTD 
       860        870        880        890        900
ARFRPDQRFL EEGNLEAAAS EKQRVEELQR SRRRYMEENN LEHIPKFFKK 
       910        920        930 
VIDANQREAW VSNDTYWELR KDPGFSKVDS PVLW
Length:934
Mass (Da):106,306
Last modified:June 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD20F90EA34C81497
GO
Isoform 2 (identifier: Q9BZF3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     431-466: Missing.

Show »
Length:898
Mass (Da):102,293
Checksum:iFDCF238AFD0D0B79
GO
Isoform 3 (identifier: Q9BZF3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MSSDEKGISPAHKTSTPTHRSASSSTSSQRDSRQ → MHQLSLIRGNRGR
     329-329: Q → QEGPPAKGQFSTTRRRQRLAAAVATT

Show »
Length:938
Mass (Da):106,864
Checksum:i275936D5B48740FF
GO
Isoform 4 (identifier: Q9BZF3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     298-328: Missing.

Show »
Length:903
Mass (Da):102,635
Checksum:i612100E10BD6C501
GO
Isoform 5 (identifier: Q9BZF3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     329-329: Q → QEGPPAKGQFSTTRRRQRLAAAVATT

Show »
Length:959
Mass (Da):108,959
Checksum:iD0D688B86FECA73D
GO
Isoform 6 (identifier: Q9BZF3-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     298-328: Missing.
     431-466: Missing.
     541-575: ILNGELTGGAFRNGRRACLPAPCPDTSNINLWNIL → SMHHLSFQVVLSTCQIATRRLNEQAFPLPRHPHPC
     576-934: Missing.

Show »
Length:508
Mass (Da):56,951
Checksum:iDF8ED83EB1DC131D
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB55223 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAD92135 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti319S → G in BAB55223 (PubMed:14702039).Curated1
Sequence conflicti350A → V in BAG62123 (PubMed:14702039).Curated1
Sequence conflicti487S → P in BAC04248 (PubMed:14702039).Curated1
Sequence conflicti714N → S in BAB55223 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05766353R → Q. Corresponds to variant dbSNP:rs35032920Ensembl.1
Natural variantiVAR_05355058P → L. Corresponds to variant dbSNP:rs34874235Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0365591 – 34MSSDE…RDSRQ → MHQLSLIRGNRGR in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_036560298 – 328Missing in isoform 4 and isoform 6. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_036561329Q → QEGPPAKGQFSTTRRRQRLA AAVATT in isoform 3 and isoform 5. 2 Publications1
Alternative sequenceiVSP_010013431 – 466Missing in isoform 2 and isoform 6. 2 PublicationsAdd BLAST36
Alternative sequenceiVSP_054430541 – 575ILNGE…LWNIL → SMHHLSFQVVLSTCQIATRR LNEQAFPLPRHPHPC in isoform 6. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_054431576 – 934Missing in isoform 6. 1 PublicationAdd BLAST359

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF323728 mRNA Translation: AAG53409.1
AF392448 mRNA Translation: AAL40661.1
AF462443 mRNA Translation: AAP97711.1
AK027600 mRNA Translation: BAB55223.1 Different initiation.
AK093902 mRNA Translation: BAC04248.1
AK300389 mRNA Translation: BAG62123.1
AB208898 mRNA Translation: BAD92135.1 Different initiation.
AC009948 Genomic DNA Translation: AAX88881.1
AC011743 Genomic DNA Translation: AAY15090.1
AC011238 Genomic DNA No translation available.
CH471058 Genomic DNA Translation: EAX11040.1
CH471058 Genomic DNA Translation: EAX11041.1
CH471058 Genomic DNA Translation: EAX11042.1
CH471058 Genomic DNA Translation: EAX11043.1
BC052259 mRNA Translation: AAH52259.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS2277.1 [Q9BZF3-1]
CCDS2278.1 [Q9BZF3-3]
CCDS56150.1 [Q9BZF3-5]
CCDS56151.1 [Q9BZF3-2]
CCDS56152.1 [Q9BZF3-4]

NCBI Reference Sequences

More...RefSeqi		NP_001188409.1, NM_001201480.1 [Q9BZF3-5]
NP_001188410.1, NM_001201481.1 [Q9BZF3-4]
NP_001188411.1, NM_001201482.1 [Q9BZF3-2]
NP_115912.1, NM_032523.3 [Q9BZF3-1]
NP_665682.1, NM_145739.2 [Q9BZF3-3]
XP_016858755.1, XM_017003266.1 [Q9BZF3-5]
XP_016858756.1, XM_017003267.1 [Q9BZF3-5]
XP_016858759.1, XM_017003270.1 [Q9BZF3-4]
XP_016858760.1, XM_017003271.1 [Q9BZF3-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000190611; ENSP00000190611; ENSG00000079156 [Q9BZF3-1]
ENST00000315022; ENSP00000318723; ENSG00000079156 [Q9BZF3-3]
ENST00000357080; ENSP00000349591; ENSG00000079156 [Q9BZF3-6]
ENST00000359685; ENSP00000352713; ENSG00000079156 [Q9BZF3-2]
ENST00000392505; ENSP00000376293; ENSG00000079156 [Q9BZF3-5]
ENST00000409045; ENSP00000387248; ENSG00000079156 [Q9BZF3-4]
ENST00000409631; ENSP00000386885; ENSG00000079156 [Q9BZF3-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		114880

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:114880

UCSC genome browser

More...UCSCi		uc002ulw.4, human [Q9BZF3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF323728 mRNA Translation: AAG53409.1
AF392448 mRNA Translation: AAL40661.1
AF462443 mRNA Translation: AAP97711.1
AK027600 mRNA Translation: BAB55223.1 Different initiation.
AK093902 mRNA Translation: BAC04248.1
AK300389 mRNA Translation: BAG62123.1
AB208898 mRNA Translation: BAD92135.1 Different initiation.
AC009948 Genomic DNA Translation: AAX88881.1
AC011743 Genomic DNA Translation: AAY15090.1
AC011238 Genomic DNA No translation available.
CH471058 Genomic DNA Translation: EAX11040.1
CH471058 Genomic DNA Translation: EAX11041.1
CH471058 Genomic DNA Translation: EAX11042.1
CH471058 Genomic DNA Translation: EAX11043.1
BC052259 mRNA Translation: AAH52259.1
CCDSiCCDS2277.1 [Q9BZF3-1]
CCDS2278.1 [Q9BZF3-3]
CCDS56150.1 [Q9BZF3-5]
CCDS56151.1 [Q9BZF3-2]
CCDS56152.1 [Q9BZF3-4]
RefSeqiNP_001188409.1, NM_001201480.1 [Q9BZF3-5]
NP_001188410.1, NM_001201481.1 [Q9BZF3-4]
NP_001188411.1, NM_001201482.1 [Q9BZF3-2]
NP_115912.1, NM_032523.3 [Q9BZF3-1]
NP_665682.1, NM_145739.2 [Q9BZF3-3]
XP_016858755.1, XM_017003266.1 [Q9BZF3-5]
XP_016858756.1, XM_017003267.1 [Q9BZF3-5]
XP_016858759.1, XM_017003270.1 [Q9BZF3-4]
XP_016858760.1, XM_017003271.1 [Q9BZF3-2]

3D structure databases

SMRiQ9BZF3
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi125381, 53 interactors
ELMiQ9BZF3
IntActiQ9BZF3, 27 interactors
MINTiQ9BZF3
STRINGi9606.ENSP00000376293

PTM databases

iPTMnetiQ9BZF3
PhosphoSitePlusiQ9BZF3

Polymorphism and mutation databases

BioMutaiOSBPL6
DMDMi20139133

Proteomic databases

EPDiQ9BZF3
jPOSTiQ9BZF3
MassIVEiQ9BZF3
MaxQBiQ9BZF3
PaxDbiQ9BZF3
PeptideAtlasiQ9BZF3
PRIDEiQ9BZF3
ProteomicsDBi69974
79831 [Q9BZF3-1]
79832 [Q9BZF3-2]
79833 [Q9BZF3-3]
79834 [Q9BZF3-4]
79835 [Q9BZF3-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		33930, 124 antibodies

Genome annotation databases

EnsembliENST00000190611; ENSP00000190611; ENSG00000079156 [Q9BZF3-1]
ENST00000315022; ENSP00000318723; ENSG00000079156 [Q9BZF3-3]
ENST00000357080; ENSP00000349591; ENSG00000079156 [Q9BZF3-6]
ENST00000359685; ENSP00000352713; ENSG00000079156 [Q9BZF3-2]
ENST00000392505; ENSP00000376293; ENSG00000079156 [Q9BZF3-5]
ENST00000409045; ENSP00000387248; ENSG00000079156 [Q9BZF3-4]
ENST00000409631; ENSP00000386885; ENSG00000079156 [Q9BZF3-2]
GeneIDi114880
KEGGihsa:114880
UCSCiuc002ulw.4, human [Q9BZF3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		114880
DisGeNETi114880
EuPathDBiHostDB:ENSG00000079156.16

GeneCards: human genes, protein and diseases

More...GeneCardsi		OSBPL6
HGNCiHGNC:16388, OSBPL6
HPAiENSG00000079156, Tissue enhanced (skeletal)
MIMi606734, gene
neXtProtiNX_Q9BZF3
OpenTargetsiENSG00000079156
PharmGKBiPA32830

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1737, Eukaryota
GeneTreeiENSGT00940000156791
HOGENOMiCLU_007105_4_1_1
InParanoidiQ9BZF3
OMAiSESIICE
OrthoDBi542090at2759
PhylomeDBiQ9BZF3
TreeFamiTF320922

Enzyme and pathway databases

PathwayCommonsiQ9BZF3
ReactomeiR-HSA-192105, Synthesis of bile acids and bile salts

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		114880, 4 hits in 850 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		OSBPL6, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		114880
PharosiQ9BZF3, Tbio

Protein Ontology

More...PROi		PR:Q9BZF3
RNActiQ9BZF3, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000079156, Expressed in bronchial epithelial cell and 199 other tissues
GenevisibleiQ9BZF3, HS

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR037239, OSBP_sf
IPR000648, Oxysterol-bd
IPR018494, Oxysterol-bd_CS
IPR011993, PH-like_dom_sf
IPR041680, PH_8
IPR001849, PH_domain
PANTHERiPTHR10972, PTHR10972, 1 hit
PfamiView protein in Pfam
PF01237, Oxysterol_BP, 1 hit
PF15409, PH_8, 1 hit
SMARTiView protein in SMART
SM00233, PH, 1 hit
SUPFAMiSSF144000, SSF144000, 1 hit
PROSITEiView protein in PROSITE
PS01013, OSBP, 1 hit
PS50003, PH_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiOSBL6_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BZF3
Secondary accession number(s): B4DTW1
, C4AMC0, C4AME4, D3DPF6, D3DPF7, Q4ZG68, Q53T68, Q59H61, Q7Z4Q1, Q86V84, Q8N9T0, Q96SR1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 11, 2002
Last sequence update: June 1, 2001
Last modified: December 2, 2020
This is version 164 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again