Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 173 (10 Feb 2021)
Sequence version 2 (25 Oct 2005)
Previous versions | rss
Add a publicationFeedback
Protein

Tripartite motif-containing protein 55

Gene

TRIM55

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May regulate gene expression and protein turnover in muscle cells.By similarity

Caution

It is uncertain whether Met-1 or Met-17 is the initiator.Curated
Variant Arg-343 is erroneously reported as Trp-343 in PubMed:24865491.Curated

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri10 – 66RING-typePROSITE-ProRule annotationAdd BLAST57
Zinc fingeri103 – 145B box-typePROSITE-ProRule annotationAdd BLAST43

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMuscle protein
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9BYV6

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tripartite motif-containing protein 55
Alternative name(s):
Muscle-specific RING finger protein 2
Short name:
MuRF-2
Short name:
MuRF2
RING finger protein 29
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TRIM55
Synonyms:MURF2, RNF29
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14215, TRIM55

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606469, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BYV6

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000147573.16

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
84675

Open Targets

More...
OpenTargetsi
ENSG00000147573

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA34432

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9BYV6, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TRIM55

Domain mapping of disease mutations (DMDM)

More...
DMDMi
78099806

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000562861 – 548Tripartite motif-containing protein 55Add BLAST548

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9BYV6

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9BYV6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BYV6

PeptideAtlas

More...
PeptideAtlasi
Q9BYV6

PRoteomics IDEntifications database

More...
PRIDEi
Q9BYV6

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
79714 [Q9BYV6-1]
79715 [Q9BYV6-2]
79716 [Q9BYV6-3]
79717 [Q9BYV6-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BYV6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BYV6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in muscle. Low-level expression in liver.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000147573, Expressed in heart and 109 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BYV6, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000147573, Group enriched (heart muscle, liver, skeletal muscle, tongue)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homooligomer and heterooligomer (Probable).

Interacts with titin/TTN.

Interacts with myosins.

Interacts with SQSTM1 and NBR1. Isoform 4 may not able to interact with isoform 1, isoform 2 and isoform 3. Probably interacts with TRIM63 and TRIM54.

Curated3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
124194, 98 interactors

Protein interaction database and analysis system

More...
IntActi
Q9BYV6, 226 interactors

Molecular INTeraction database

More...
MINTi
Q9BYV6

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000323913

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9BYV6, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9BYV6

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini269 – 327COSPROSITE-ProRule annotationAdd BLAST59

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili168 – 248Sequence analysisAdd BLAST81

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri10 – 66RING-typePROSITE-ProRule annotationAdd BLAST57
Zinc fingeri103 – 145B box-typePROSITE-ProRule annotationAdd BLAST43

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2177, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154004

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_013137_5_3_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BYV6

Identification of Orthologs from Complete Genome Data

More...
OMAi
AMMVGNN

Database of Orthologous Groups

More...
OrthoDBi
824972at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BYV6

TreeFam database of animal gene trees

More...
TreeFami
TF331669

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00021, BBOX, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR017903, COS_domain
IPR033492, TRIM54/TRIM55
IPR027370, Znf-RING_LisH
IPR000315, Znf_B-box
IPR001841, Znf_RING
IPR013083, Znf_RING/FYVE/PHD
IPR017907, Znf_RING_CS

The PANTHER Classification System

More...
PANTHERi
PTHR25462:SF257, PTHR25462:SF257, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00643, zf-B_box, 1 hit
PF13445, zf-RING_UBOX, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00336, BBOX, 1 hit
SM00184, RING, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51262, COS, 1 hit
PS50119, ZF_BBOX, 1 hit
PS00518, ZF_RING_1, 1 hit
PS50089, ZF_RING_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q9BYV6-1) [UniParc]FASTAAdd to basket
Also known as: p60

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSASLNYKSF SKEQQTMDNL EKQLICPICL EMFTKPVVIL PCQHNLCRKC
60 70 80 90 100
ASDIFQASNP YLPTRGGTTM ASGGRFRCPS CRHEVVLDRH GVYGLQRNLL
110 120 130 140 150
VENIIDIYKQ ESTRPEKKSD QPMCEEHEEE RINIYCLNCE VPTCSLCKVF
160 170 180 190 200
GAHKDCQVAP LTHVFQRQKS ELSDGIAILV GSNDRVQGVI SQLEDTCKTI
210 220 230 240 250
EECCRKQKQE LCEKFDYLYG ILEERKNEMT QVITRTQEEK LEHVRALIKK
260 270 280 290 300
YSDHLENVSK LVESGIQFMD EPEMAVFLQN AKTLLKKISE ASKAFQMEKI
310 320 330 340 350
EHGYENMNHF TVNLNREEKI IREIDFYRED EDEEEEEGGE GEKEGEGEVG
360 370 380 390 400
GEAVEVEEVE NVQTEFPGED ENPEKASELS QVELQAAPGA LPVSSPEPPP
410 420 430 440 450
ALPPAADAPV TQGEVVPTGS EQTTESETPV PAAAETADPL FYPSWYKGQT
460 470 480 490 500
RKATTNPPCT PGSEGLGQIG PPGSEDSNVR KAEVAAAAAS ERAAVSGKET
510 520 530 540
SAPAATSQIG FEAPPLQGQA AAPASGSGAD SEPARHIFSF SWLNSLNE
Length:548
Mass (Da):60,466
Last modified:October 25, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2AA2E4D4F5C3E3A1
GO
Isoform 2 (identifier: Q9BYV6-2) [UniParc]FASTAAdd to basket
Also known as: p50

The sequence of this isoform differs from the canonical sequence as follows:
     412-507: Missing.

Show »
Length:452
Mass (Da):50,823
Checksum:i47E656DC77628A45
GO
Isoform 3 (identifier: Q9BYV6-3) [UniParc]FASTAAdd to basket
Also known as: p60B

The sequence of this isoform differs from the canonical sequence as follows:
     509-548: IGFEAPPLQGQAAAPASGSGADSEPARHIFSFSWLNSLNE → ELVICLALLAFLILHYIWSQIQCLIFTLMDWI

Show »
Length:540
Mass (Da):60,174
Checksum:i5F017CFB82982E81
GO
Isoform 4 (identifier: Q9BYV6-4) [UniParc]FASTAAdd to basket
Also known as: p27

The sequence of this isoform differs from the canonical sequence as follows:
     202-508: Missing.

Show »
Length:241
Mass (Da):26,841
Checksum:i21951B79C1B89B37
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAP35876 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAC32839 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAC32840 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti102E → G in CAC43019 (PubMed:12414993).Curated1
Sequence conflicti102E → G in CAC43020 (PubMed:12414993).Curated1
Sequence conflicti345G → E in CAC43019 (PubMed:12414993).Curated1
Sequence conflicti345G → E in CAC43020 (PubMed:12414993).Curated1
Sequence conflicti345G → E in CAD24432 (PubMed:12414993).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_07407850C → Y Rare variant; found in a patient with hypertrophic cardiomyopathy; unknown pathological significance. 1 Publication1
Natural variantiVAR_07407954I → V1 PublicationCorresponds to variant dbSNP:rs1320007526Ensembl.1
Natural variantiVAR_07408079P → A Rare variant; found in a patient with hypertrophic cardiomyopathy; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs769797275Ensembl.1
Natural variantiVAR_074081241L → M Rare variant; found in a patient with hypertrophic cardiomyopathy; unknown pathological significance. 1 Publication1
Natural variantiVAR_074082252S → F1 Publication1
Natural variantiVAR_074083257N → K1 PublicationCorresponds to variant dbSNP:rs61741078Ensembl.1
Natural variantiVAR_074084258V → I1 PublicationCorresponds to variant dbSNP:rs1279027783Ensembl.1
Natural variantiVAR_074085336E → Q1 PublicationCorresponds to variant dbSNP:rs770907206Ensembl.1
Natural variantiVAR_052144343K → R1 PublicationCorresponds to variant dbSNP:rs7843605Ensembl.1
Natural variantiVAR_074086392P → T Rare variant; found in a patient with hypertrophic cardiomyopathy; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs200545859Ensembl.1
Natural variantiVAR_074087418T → I1 Publication1
Natural variantiVAR_074088452K → N Rare variant; found in a patient with hypertrophic cardiomyopathy; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs755876598Ensembl.1
Natural variantiVAR_074089458P → L1 Publication1
Natural variantiVAR_074090488A → T1 PublicationCorresponds to variant dbSNP:rs770146015Ensembl.1
Natural variantiVAR_074091506T → S Rare variant; found in a patient with hypertrophic cardiomyopathy; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs781152511Ensembl.1
Isoform 3 (identifier: Q9BYV6-3)
Natural variantiVAR_082913523H → R1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_015996202 – 508Missing in isoform 4. 1 PublicationAdd BLAST307
Alternative sequenceiVSP_015997412 – 507Missing in isoform 2. 5 PublicationsAdd BLAST96
Alternative sequenceiVSP_015998509 – 548IGFEA…NSLNE → ELVICLALLAFLILHYIWSQ IQCLIFTLMDWI in isoform 3. 1 PublicationAdd BLAST40

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ291712 mRNA Translation: CAC32839.1 Different initiation.
AJ291712 mRNA Translation: CAC32840.1 Different initiation.
AJ243488 mRNA Translation: CAC43019.1
AJ243489 mRNA Translation: CAC43020.1
AJ277493 mRNA Translation: CAC81835.1
AJ431704 mRNA Translation: CAD24432.1
AK091310 mRNA Translation: BAG52332.1
AK091728 mRNA Translation: BAG52405.1
CH471068 Genomic DNA Translation: EAW86894.1
CH471068 Genomic DNA Translation: EAW86895.1
BC007750 mRNA Translation: AAH07750.2
BT007212 mRNA Translation: AAP35876.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS6184.1 [Q9BYV6-1]
CCDS6185.1 [Q9BYV6-2]
CCDS6186.1 [Q9BYV6-4]
CCDS6187.1 [Q9BYV6-3]

NCBI Reference Sequences

More...
RefSeqi
NP_149047.2, NM_033058.2 [Q9BYV6-3]
NP_908973.1, NM_184085.1 [Q9BYV6-1]
NP_908974.1, NM_184086.1 [Q9BYV6-2]
NP_908975.1, NM_184087.1 [Q9BYV6-4]
XP_011515915.1, XM_011517613.2 [Q9BYV6-1]
XP_011515916.1, XM_011517614.2 [Q9BYV6-1]
XP_011515917.1, XM_011517615.2 [Q9BYV6-3]
XP_011515918.1, XM_011517616.2 [Q9BYV6-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000276573; ENSP00000276573; ENSG00000147573 [Q9BYV6-3]
ENST00000315962; ENSP00000323913; ENSG00000147573 [Q9BYV6-1]
ENST00000350034; ENSP00000332302; ENSG00000147573 [Q9BYV6-4]
ENST00000353317; ENSP00000297348; ENSG00000147573 [Q9BYV6-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84675

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84675

UCSC genome browser

More...
UCSCi
uc003xvu.4, human [Q9BYV6-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ291712 mRNA Translation: CAC32839.1 Different initiation.
AJ291712 mRNA Translation: CAC32840.1 Different initiation.
AJ243488 mRNA Translation: CAC43019.1
AJ243489 mRNA Translation: CAC43020.1
AJ277493 mRNA Translation: CAC81835.1
AJ431704 mRNA Translation: CAD24432.1
AK091310 mRNA Translation: BAG52332.1
AK091728 mRNA Translation: BAG52405.1
CH471068 Genomic DNA Translation: EAW86894.1
CH471068 Genomic DNA Translation: EAW86895.1
BC007750 mRNA Translation: AAH07750.2
BT007212 mRNA Translation: AAP35876.1 Different initiation.
CCDSiCCDS6184.1 [Q9BYV6-1]
CCDS6185.1 [Q9BYV6-2]
CCDS6186.1 [Q9BYV6-4]
CCDS6187.1 [Q9BYV6-3]
RefSeqiNP_149047.2, NM_033058.2 [Q9BYV6-3]
NP_908973.1, NM_184085.1 [Q9BYV6-1]
NP_908974.1, NM_184086.1 [Q9BYV6-2]
NP_908975.1, NM_184087.1 [Q9BYV6-4]
XP_011515915.1, XM_011517613.2 [Q9BYV6-1]
XP_011515916.1, XM_011517614.2 [Q9BYV6-1]
XP_011515917.1, XM_011517615.2 [Q9BYV6-3]
XP_011515918.1, XM_011517616.2 [Q9BYV6-2]

3D structure databases

SMRiQ9BYV6
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi124194, 98 interactors
IntActiQ9BYV6, 226 interactors
MINTiQ9BYV6
STRINGi9606.ENSP00000323913

PTM databases

iPTMnetiQ9BYV6
PhosphoSitePlusiQ9BYV6

Genetic variation databases

BioMutaiTRIM55
DMDMi78099806

Proteomic databases

MassIVEiQ9BYV6
MaxQBiQ9BYV6
PaxDbiQ9BYV6
PeptideAtlasiQ9BYV6
PRIDEiQ9BYV6
ProteomicsDBi79714 [Q9BYV6-1]
79715 [Q9BYV6-2]
79716 [Q9BYV6-3]
79717 [Q9BYV6-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
24808, 177 antibodies

The DNASU plasmid repository

More...
DNASUi
84675

Genome annotation databases

EnsembliENST00000276573; ENSP00000276573; ENSG00000147573 [Q9BYV6-3]
ENST00000315962; ENSP00000323913; ENSG00000147573 [Q9BYV6-1]
ENST00000350034; ENSP00000332302; ENSG00000147573 [Q9BYV6-4]
ENST00000353317; ENSP00000297348; ENSG00000147573 [Q9BYV6-2]
GeneIDi84675
KEGGihsa:84675
UCSCiuc003xvu.4, human [Q9BYV6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84675
DisGeNETi84675

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TRIM55
HGNCiHGNC:14215, TRIM55
HPAiENSG00000147573, Group enriched (heart muscle, liver, skeletal muscle, tongue)
MIMi606469, gene
neXtProtiNX_Q9BYV6
OpenTargetsiENSG00000147573
PharmGKBiPA34432
VEuPathDBiHostDB:ENSG00000147573.16

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2177, Eukaryota
GeneTreeiENSGT00940000154004
HOGENOMiCLU_013137_5_3_1
InParanoidiQ9BYV6
OMAiAMMVGNN
OrthoDBi824972at2759
PhylomeDBiQ9BYV6
TreeFamiTF331669

Enzyme and pathway databases

PathwayCommonsiQ9BYV6

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
84675, 2 hits in 878 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TRIM55, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
TRIM55

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84675
PharosiQ9BYV6, Tdark

Protein Ontology

More...
PROi
PR:Q9BYV6
RNActiQ9BYV6, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000147573, Expressed in heart and 109 other tissues
GenevisibleiQ9BYV6, HS

Family and domain databases

CDDicd00021, BBOX, 1 hit
Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR017903, COS_domain
IPR033492, TRIM54/TRIM55
IPR027370, Znf-RING_LisH
IPR000315, Znf_B-box
IPR001841, Znf_RING
IPR013083, Znf_RING/FYVE/PHD
IPR017907, Znf_RING_CS
PANTHERiPTHR25462:SF257, PTHR25462:SF257, 1 hit
PfamiView protein in Pfam
PF00643, zf-B_box, 1 hit
PF13445, zf-RING_UBOX, 1 hit
SMARTiView protein in SMART
SM00336, BBOX, 1 hit
SM00184, RING, 1 hit
PROSITEiView protein in PROSITE
PS51262, COS, 1 hit
PS50119, ZF_BBOX, 1 hit
PS00518, ZF_RING_1, 1 hit
PS50089, ZF_RING_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTRI55_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BYV6
Secondary accession number(s): B3KRC0
, B3KRJ3, Q53XX3, Q8IUD9, Q8IUE4, Q96DV2, Q96DV3, Q9BYV5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 6, 2002
Last sequence update: October 25, 2005
Last modified: February 10, 2021
This is version 173 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human entries with genetic variants
    List of human entries with genetic variants
  2. Human variants curated from literature reports
    Index of human variants curated from literature reports
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again