Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 145 (17 Jun 2020)
Sequence version 2 (04 Dec 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein maestro

Gene

MRO

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein maestro
Alternative name(s):
Male-specific transcription in the developing reproductive organs
Protein B29
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MRO
Synonyms:B29, C18orf3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 18

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000134042.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24121 MRO

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608080 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BYG7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
83876

Open Targets

More...
OpenTargetsi
ENSG00000134042

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134932281

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9BYG7 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MRO

Domain mapping of disease mutations (DMDM)

More...
DMDMi
161789016

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002481971 – 248Protein maestroAdd BLAST248

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BYG7

PeptideAtlas

More...
PeptideAtlasi
Q9BYG7

PRoteomics IDEntifications database

More...
PRIDEi
Q9BYG7

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
19076
19229
79641 [Q9BYG7-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BYG7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BYG7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000134042 Expressed in female gonad and 152 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9BYG7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BYG7 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000134042 Tissue enhanced (brain, kidney, testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000397900

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9BYG7 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati128 – 163HEATAdd BLAST36

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2032 Eukaryota
ENOG410XQE8 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161642

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_099676_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BYG7

Identification of Orthologs from Complete Genome Data

More...
OMAi
QFLYANK

Database of Orthologous Groups

More...
OrthoDBi
31329at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BYG7

TreeFam database of animal gene trees

More...
TreeFami
TF343191

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016024 ARM-type_fold

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48371 SSF48371, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BYG7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDQRQRRILG QPLSIPTSQP KQKRTSMISF FSKVSWKLRF QKREPLKNVF
60 70 80 90 100
FILAERARDP SAKKRHMAMR NLGTMAYEAP DKVRKYKKIV LDLLVYGLYD
110 120 130 140 150
PVNLEVIHES MKTLTVVLGK IQGKGLGSFF IDITLQTRTL LDDENDSLRY
160 170 180 190 200
SAFVLFGQLA AFAGRKWKKF FTSQVKQTRD SLLIHLQDRN PQVAKACKTT
210 220 230 240
FQACSPYLKL KEEYSFQSEE DQRNTKLYQQ LSHYHPEILQ FFYANKIL
Length:248
Mass (Da):29,054
Last modified:December 4, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i57E43D6085BFF069
GO
Isoform 2 (identifier: Q9BYG7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MDQRQRRILGQPLSIPTSQPKQKRTSMISFFSK → MAWGSKGIQG...SRGSRLQEPQ
     144-195: Missing.

Show »
Length:210
Mass (Da):24,055
Checksum:i349CDF4A8E32B848
GO
Isoform 3 (identifier: Q9BYG7-3)
Sequence is not available
Length:
Mass (Da):
Isoform 4 (identifier: Q9BYG7-4)
Sequence is not available
Length:
Mass (Da):
Isoform 5 (identifier: Q9BYG7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MDQRQRRILGQPLSIPTSQPKQKRTSMISFFSK → MAWGSKGIQG...SRGSRLQEPQ

Show »
Length:262
Mass (Da):30,093
Checksum:iCE5A7AA63055DAE8
GO
Isoform 6 (identifier: Q9BYG7-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     144-195: Missing.

Show »
Length:196
Mass (Da):23,016
Checksum:i49FC39BAA95E8A0C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EKU2K7EKU2_HUMAN
Protein maestro
MRO
110Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ELT8K7ELT8_HUMAN
Protein maestro
MRO
47Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EPK7K7EPK7_HUMAN
Protein maestro
MRO
179Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02726139R → S1 PublicationCorresponds to variant dbSNP:rs4940019Ensembl.1
Natural variantiVAR_027262134T → A3 PublicationsCorresponds to variant dbSNP:rs2849233Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0457111 – 33MDQRQ…SFFSK → MAWGSKGIQGWENLAESSHL ATTRESSPPESGTGSGSSRG SRLQEPQ in isoform 2 and isoform 5. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_045712144 – 195Missing in isoform 2 and isoform 6. 1 PublicationAdd BLAST52

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB042647 mRNA Translation: BAB40981.1
AK294757 mRNA Translation: BAH11871.1
AK054702 mRNA Translation: BAB70797.1
AK295666 mRNA Translation: BAH12148.1
AC015864 Genomic DNA No translation available.
BC029860 mRNA Translation: AAH29860.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11947.1 [Q9BYG7-1]
CCDS45867.1 [Q9BYG7-2]
CCDS45868.1 [Q9BYG7-5]
CCDS45869.1 [Q9BYG7-6]

NCBI Reference Sequences

More...
RefSeqi
NP_001120646.1, NM_001127174.1 [Q9BYG7-6]
NP_001120647.1, NM_001127175.1 [Q9BYG7-2]
NP_001120648.1, NM_001127176.1 [Q9BYG7-5]
NP_114145.2, NM_031939.3 [Q9BYG7-1]
XP_005258422.1, XM_005258365.3
XP_011524528.1, XM_011526226.2 [Q9BYG7-6]
XP_016881524.1, XM_017026035.1 [Q9BYG7-1]
XP_016881525.1, XM_017026036.1
XP_016881526.1, XM_017026037.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000256425; ENSP00000256425; ENSG00000134042 [Q9BYG7-1]
ENST00000398439; ENSP00000381465; ENSG00000134042 [Q9BYG7-1]
ENST00000428869; ENSP00000409509; ENSG00000134042 [Q9BYG7-1]
ENST00000431965; ENSP00000392614; ENSG00000134042 [Q9BYG7-2]
ENST00000436348; ENSP00000397900; ENSG00000134042 [Q9BYG7-5]
ENST00000588444; ENSP00000465653; ENSG00000134042 [Q9BYG7-6]
ENST00000610511; ENSP00000482576; ENSG00000134042 [Q9BYG7-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
83876

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:83876

UCSC genome browser

More...
UCSCi
uc002lew.5 human [Q9BYG7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB042647 mRNA Translation: BAB40981.1
AK294757 mRNA Translation: BAH11871.1
AK054702 mRNA Translation: BAB70797.1
AK295666 mRNA Translation: BAH12148.1
AC015864 Genomic DNA No translation available.
BC029860 mRNA Translation: AAH29860.1
CCDSiCCDS11947.1 [Q9BYG7-1]
CCDS45867.1 [Q9BYG7-2]
CCDS45868.1 [Q9BYG7-5]
CCDS45869.1 [Q9BYG7-6]
RefSeqiNP_001120646.1, NM_001127174.1 [Q9BYG7-6]
NP_001120647.1, NM_001127175.1 [Q9BYG7-2]
NP_001120648.1, NM_001127176.1 [Q9BYG7-5]
NP_114145.2, NM_031939.3 [Q9BYG7-1]
XP_005258422.1, XM_005258365.3
XP_011524528.1, XM_011526226.2 [Q9BYG7-6]
XP_016881524.1, XM_017026035.1 [Q9BYG7-1]
XP_016881525.1, XM_017026036.1
XP_016881526.1, XM_017026037.1

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi9606.ENSP00000397900

PTM databases

iPTMnetiQ9BYG7
PhosphoSitePlusiQ9BYG7

Polymorphism and mutation databases

BioMutaiMRO
DMDMi161789016

Proteomic databases

PaxDbiQ9BYG7
PeptideAtlasiQ9BYG7
PRIDEiQ9BYG7
ProteomicsDBi19076
19229
79641 [Q9BYG7-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
58882 32 antibodies

The DNASU plasmid repository

More...
DNASUi
83876

Genome annotation databases

EnsembliENST00000256425; ENSP00000256425; ENSG00000134042 [Q9BYG7-1]
ENST00000398439; ENSP00000381465; ENSG00000134042 [Q9BYG7-1]
ENST00000428869; ENSP00000409509; ENSG00000134042 [Q9BYG7-1]
ENST00000431965; ENSP00000392614; ENSG00000134042 [Q9BYG7-2]
ENST00000436348; ENSP00000397900; ENSG00000134042 [Q9BYG7-5]
ENST00000588444; ENSP00000465653; ENSG00000134042 [Q9BYG7-6]
ENST00000610511; ENSP00000482576; ENSG00000134042 [Q9BYG7-1]
GeneIDi83876
KEGGihsa:83876
UCSCiuc002lew.5 human [Q9BYG7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
83876
DisGeNETi83876
EuPathDBiHostDB:ENSG00000134042.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MRO
HGNCiHGNC:24121 MRO
HPAiENSG00000134042 Tissue enhanced (brain, kidney, testis)
MIMi608080 gene
neXtProtiNX_Q9BYG7
OpenTargetsiENSG00000134042
PharmGKBiPA134932281

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2032 Eukaryota
ENOG410XQE8 LUCA
GeneTreeiENSGT00940000161642
HOGENOMiCLU_099676_0_0_1
InParanoidiQ9BYG7
OMAiQFLYANK
OrthoDBi31329at2759
PhylomeDBiQ9BYG7
TreeFamiTF343191

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
83876 1 hit in 790 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MRO human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
83876
PharosiQ9BYG7 Tdark

Protein Ontology

More...
PROi
PR:Q9BYG7
RNActiQ9BYG7 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000134042 Expressed in female gonad and 152 other tissues
ExpressionAtlasiQ9BYG7 baseline and differential
GenevisibleiQ9BYG7 HS

Family and domain databases

InterProiView protein in InterPro
IPR016024 ARM-type_fold
SUPFAMiSSF48371 SSF48371, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMSTRO_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BYG7
Secondary accession number(s): B7Z2I5
, B7Z3B2, E9PAT5, E9PBI3, K7EKJ8, Q8N6K5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 5, 2006
Last sequence update: December 4, 2007
Last modified: June 17, 2020
This is version 145 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again