Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 143 (16 Oct 2019)
Sequence version 5 (10 Apr 2019)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Transmembrane protease serine 13

Gene

TMPRSS13

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Caution

Was termed TMPRSS6 (Ref. 3).Curated

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei366Charge relay systemBy similarity1
Active sitei414Charge relay systemBy similarity1
Active sitei511Charge relay systemBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • scavenger receptor activity Source: InterPro
  • serine-type endopeptidase activity Source: UniProtKB

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protease, Serine protease

Protein family/group databases

MEROPS protease database

More...
MEROPSi
S01.087

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transmembrane protease serine 13 (EC:3.4.21.-)
Alternative name(s):
Membrane-type mosaic serine protease
Short name:
Mosaic serine protease
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TMPRSS13
Synonyms:MSP, TMPRSS11
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29808 TMPRSS13

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610050 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BYE2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 165CytoplasmicSequence analysisAdd BLAST165
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei166 – 186Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini187 – 586ExtracellularSequence analysisAdd BLAST400

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
84000

Open Targets

More...
OpenTargetsi
ENSG00000137747

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142670732

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9BYE2

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TMPRSS13

Domain mapping of disease mutations (DMDM)

More...
DMDMi
313104278

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000886981 – 586Transmembrane protease serine 13Add BLAST586

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi250 ↔ 314By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi255N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi263 ↔ 317By similarity
Glycosylationi292N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi351 ↔ 367By similarity
Glycosylationi405N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi445N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi448 ↔ 517By similarity
Disulfide bondi480 ↔ 496By similarity
Disulfide bondi507 ↔ 535By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9BYE2

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9BYE2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BYE2

PeptideAtlas

More...
PeptideAtlasi
Q9BYE2

PRoteomics IDEntifications database

More...
PRIDEi
Q9BYE2

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
20829
23254
30511
79624 [Q9BYE2-1]
79625 [Q9BYE2-2]
79626 [Q9BYE2-3]
79627 [Q9BYE2-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BYE2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BYE2

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q9BYE2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 and isoform 3 are predominantly expressed in lung, placenta, pancreas, and prostate. Isoform 3 is weakly expressed in testis and peripheral blood lymphocytes.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000137747 Expressed in 98 organ(s), highest expression level in skin of leg

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9BYE2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BYE2 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123845, 4 interactors

Protein interaction database and analysis system

More...
IntActi
Q9BYE2, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000434279

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9BYE2

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati9 – 131-15
Repeati14 – 182-1; approximate5
Repeati19 – 231-25
Repeati24 – 281-35
Repeati29 – 332-25
Repeati34 – 381-45
Repeati39 – 431-55
Repeati44 – 481-65
Repeati49 – 532-35
Repeati54 – 581-75
Repeati59 – 631-85
Repeati64 – 682-45
Repeati69 – 781-9; approximate10
Repeati79 – 831-105
Repeati84 – 881-115
Repeati89 – 931-125
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini195 – 325SRCRPROSITE-ProRule annotationAdd BLAST131
Domaini204 – 226LDL-receptor class AAdd BLAST23
Domaini326 – 559Peptidase S1PROSITE-ProRule annotationAdd BLAST234

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni9 – 9313 X 5 AA repeats of A-S-P-A-[GLQR]Add BLAST85
Regioni14 – 684 X 5 AA repeats of T-P-P-G-RAdd BLAST55

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi9 – 94Ala-richAdd BLAST86

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase S1 family.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3627 Eukaryota
COG5640 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159197

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000251822

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BYE2

KEGG Orthology (KO)

More...
KOi
K09643

Identification of Orthologs from Complete Genome Data

More...
OMAi
CEQNSRW

Database of Orthologous Groups

More...
OrthoDBi
1314811at2759

TreeFam database of animal gene trees

More...
TreeFami
TF351678

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00112 LDLa, 1 hit
cd00190 Tryp_SPc, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.10.250.10, 1 hit
4.10.400.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036055 LDL_receptor-like_sf
IPR002172 LDrepeatLR_classA_rpt
IPR009003 Peptidase_S1_PA
IPR001314 Peptidase_S1A
IPR017327 Peptidase_S1A_TMPRSS13
IPR001190 SRCR
IPR017448 SRCR-like_dom
IPR036772 SRCR-like_dom_sf
IPR001254 Trypsin_dom
IPR018114 TRYPSIN_HIS
IPR033116 TRYPSIN_SER

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15494 SRCR_2, 1 hit
PF00089 Trypsin, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF037935 TMPRSS13, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00722 CHYMOTRYPSIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00202 SR, 1 hit
SM00020 Tryp_SPc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50494 SSF50494, 1 hit
SSF56487 SSF56487, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50287 SRCR_2, 1 hit
PS50240 TRYPSIN_DOM, 1 hit
PS00134 TRYPSIN_HIS, 1 hit
PS00135 TRYPSIN_SER, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BYE2-1) [UniParc]FASTAAdd to basket
Also known as: MSPL1 Publication

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MERDSHGNAS PARTPSAGAS PAQASPAGTP PGRASPAQAS PAQASPAGTP
60 70 80 90 100
PGRASPAQAS PAGTPPGRAS PGRASPAQAS PAQASPARAS PALASLSRSS
110 120 130 140 150
SGRSSSARSA SVTTSPTRVY LVRATPVGAV PIRSSPARSA PATRATRESP
160 170 180 190 200
GTSLPKFTWR EGQKQLPLIG CVLLLIALVV SLIILFQFWQ GHTGIRYKEQ
210 220 230 240 250
RESCPKHAVR CDGVVDCKLK SDELGCVRFD WDKSLLKIYS GSSHQWLPIC
260 270 280 290 300
SSNWNDSYSE KTCQQLGFES AHRTTEVAHR DFANSFSILR YNSTIQESLH
310 320 330 340 350
RSECPSQRYI SLQCSHCGLR AMTGRIVGGA LASDSKWPWQ VSLHFGTTHI
360 370 380 390 400
CGGTLIDAQW VLTAAHCFFV TREKVLEGWK VYAGTSNLHQ LPEAASIAEI
410 420 430 440 450
IINSNYTDEE DDYDIALMRL SKPLTLSAHI HPACLPMHGQ TFSLNETCWI
460 470 480 490 500
TGFGKTRETD DKTSPFLREV QVNLIDFKKC NDYLVYDSYL TPRMMCAGDL
510 520 530 540 550
RGGRDSCQGD SGGPLVCEQN NRWYLAGVTS WGTGCGQRNK PGVYTKVTEV
560 570 580
LPWIYSKMEV RSLQQDTAPS RLGTSSGGDP GGAPRL
Length:586
Mass (Da):63,167
Last modified:April 10, 2019 - v5
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEDA2E3B7509FB1C6
GO
Isoform 2 (identifier: Q9BYE2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     560-563: VRSL → SSAG
     564-586: Missing.

Note: No experimental confirmation available.
Show »
Length:563
Mass (Da):60,807
Checksum:iE2F6B117E8B9629A
GO
Isoform 3 (identifier: Q9BYE2-3) [UniParc]FASTAAdd to basket
Also known as: MSPS1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     151-186: GTSLPKFTWREGQKQLPLIGCVLLLIALVVSLIILF → V
     560-586: VRSLQQDTAPSRLGTSSGGDPGGAPRL → SEVRFRKS

Show »
Length:532
Mass (Da):57,631
Checksum:iA7BFBF7E6E8C6AF0
GO
Isoform 4 (identifier: Q9BYE2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     428-491: AHIHPACLPM...DYLVYDSYLT → GEGICTPRSP...IIRETEAQGL
     492-586: Missing.

Note: No experimental confirmation available.
Show »
Length:491
Mass (Da):52,560
Checksum:i9D9D7FE308E593E6
GO
Isoform 6 (identifier: Q9BYE2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     560-586: VRSLQQDTAPSRLGTSSGGDPGGAPRL → SEVRFRKS

Show »
Length:567
Mass (Da):61,494
Checksum:iFACA4DA4BE99BFB7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PR79E9PR79_HUMAN
Transmembrane protease serine 13
TMPRSS13
40Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti192H → Y in AAO38062 (Ref. 3) Curated1
Sequence conflicti206K → E in AAO38062 (Ref. 3) Curated1
Sequence conflicti211C → R in AAO38062 (Ref. 3) Curated1
Sequence conflicti510D → G in BAG62041 (PubMed:14702039).Curated1
Sequence conflicti586L → V in BAB39741 (PubMed:11267681).Curated1

<p>This subsection of the ‘Sequence’ section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement_in_disease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

The repeat A-S-P-A-[GLQR] is polymorphic and the number of copies varies between 12 to 14.1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_08135473R → RASPAQ1 Publication1
Natural variantiVAR_08135574 – 78Missing 3 Publications5

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_013099151 – 186GTSLP…LIILF → V in isoform 3. 2 PublicationsAdd BLAST36
Alternative sequenceiVSP_013100428 – 491AHIHP…DSYLT → GEGICTPRSPAPQPQHPLQP SHLSASVNSYPGPKASAGQK SKTLKDPYMEHFCFIIRETE AQGL in isoform 4. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_013101492 – 586Missing in isoform 4. 1 PublicationAdd BLAST95
Alternative sequenceiVSP_013102560 – 586VRSLQ…GAPRL → SEVRFRKS in isoform 3 and isoform 6. 2 PublicationsAdd BLAST27
Alternative sequenceiVSP_013103560 – 563VRSL → SSAG in isoform 2. 1 Publication4
Alternative sequenceiVSP_013104564 – 586Missing in isoform 2. 1 PublicationAdd BLAST23

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB048796 mRNA Translation: BAB39741.2
AB048797 mRNA Translation: BAB39742.2
AY190317 mRNA Translation: AAO38062.1
AK027798 mRNA Translation: BAB55376.1
AK300283 mRNA Translation: BAG62041.1
AP002962 Genomic DNA No translation available.
BC114928 mRNA Translation: AAI14929.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41721.1 [Q9BYE2-6]
CCDS55788.1 [Q9BYE2-3]
CCDS55789.1 [Q9BYE2-4]
CCDS58185.1 [Q9BYE2-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001070731.1, NM_001077263.2 [Q9BYE2-6]
NP_001193718.1, NM_001206789.1 [Q9BYE2-3]
NP_001193719.1, NM_001206790.1 [Q9BYE2-4]
NP_001231924.1, NM_001244995.1 [Q9BYE2-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000430170; ENSP00000387702; ENSG00000137747 [Q9BYE2-2]
ENST00000445164; ENSP00000394114; ENSG00000137747 [Q9BYE2-1]
ENST00000524993; ENSP00000434279; ENSG00000137747 [Q9BYE2-6]
ENST00000526090; ENSP00000436502; ENSG00000137747 [Q9BYE2-4]
ENST00000528626; ENSP00000435813; ENSG00000137747 [Q9BYE2-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84000

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84000

UCSC genome browser

More...
UCSCi
uc001pru.3 human [Q9BYE2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB048796 mRNA Translation: BAB39741.2
AB048797 mRNA Translation: BAB39742.2
AY190317 mRNA Translation: AAO38062.1
AK027798 mRNA Translation: BAB55376.1
AK300283 mRNA Translation: BAG62041.1
AP002962 Genomic DNA No translation available.
BC114928 mRNA Translation: AAI14929.1
CCDSiCCDS41721.1 [Q9BYE2-6]
CCDS55788.1 [Q9BYE2-3]
CCDS55789.1 [Q9BYE2-4]
CCDS58185.1 [Q9BYE2-2]
RefSeqiNP_001070731.1, NM_001077263.2 [Q9BYE2-6]
NP_001193718.1, NM_001206789.1 [Q9BYE2-3]
NP_001193719.1, NM_001206790.1 [Q9BYE2-4]
NP_001231924.1, NM_001244995.1 [Q9BYE2-2]

3D structure databases

SMRiQ9BYE2
ModBaseiSearch...

Protein-protein interaction databases

BioGridi123845, 4 interactors
IntActiQ9BYE2, 1 interactor
STRINGi9606.ENSP00000434279

Protein family/group databases

MEROPSiS01.087

PTM databases

iPTMnetiQ9BYE2
PhosphoSitePlusiQ9BYE2
SwissPalmiQ9BYE2

Polymorphism and mutation databases

BioMutaiTMPRSS13
DMDMi313104278

Proteomic databases

jPOSTiQ9BYE2
MassIVEiQ9BYE2
PaxDbiQ9BYE2
PeptideAtlasiQ9BYE2
PRIDEiQ9BYE2
ProteomicsDBi20829
23254
30511
79624 [Q9BYE2-1]
79625 [Q9BYE2-2]
79626 [Q9BYE2-3]
79627 [Q9BYE2-4]

Genome annotation databases

EnsembliENST00000430170; ENSP00000387702; ENSG00000137747 [Q9BYE2-2]
ENST00000445164; ENSP00000394114; ENSG00000137747 [Q9BYE2-1]
ENST00000524993; ENSP00000434279; ENSG00000137747 [Q9BYE2-6]
ENST00000526090; ENSP00000436502; ENSG00000137747 [Q9BYE2-4]
ENST00000528626; ENSP00000435813; ENSG00000137747 [Q9BYE2-3]
GeneIDi84000
KEGGihsa:84000
UCSCiuc001pru.3 human [Q9BYE2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84000
DisGeNETi84000

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TMPRSS13
HGNCiHGNC:29808 TMPRSS13
MIMi610050 gene
neXtProtiNX_Q9BYE2
OpenTargetsiENSG00000137747
PharmGKBiPA142670732

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3627 Eukaryota
COG5640 LUCA
GeneTreeiENSGT00940000159197
HOGENOMiHOG000251822
InParanoidiQ9BYE2
KOiK09643
OMAiCEQNSRW
OrthoDBi1314811at2759
TreeFamiTF351678

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TMPRSS13 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84000
PharosiQ9BYE2

Protein Ontology

More...
PROi
PR:Q9BYE2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000137747 Expressed in 98 organ(s), highest expression level in skin of leg
ExpressionAtlasiQ9BYE2 baseline and differential
GenevisibleiQ9BYE2 HS

Family and domain databases

CDDicd00112 LDLa, 1 hit
cd00190 Tryp_SPc, 1 hit
Gene3Di3.10.250.10, 1 hit
4.10.400.10, 1 hit
InterProiView protein in InterPro
IPR036055 LDL_receptor-like_sf
IPR002172 LDrepeatLR_classA_rpt
IPR009003 Peptidase_S1_PA
IPR001314 Peptidase_S1A
IPR017327 Peptidase_S1A_TMPRSS13
IPR001190 SRCR
IPR017448 SRCR-like_dom
IPR036772 SRCR-like_dom_sf
IPR001254 Trypsin_dom
IPR018114 TRYPSIN_HIS
IPR033116 TRYPSIN_SER
PfamiView protein in Pfam
PF15494 SRCR_2, 1 hit
PF00089 Trypsin, 1 hit
PIRSFiPIRSF037935 TMPRSS13, 1 hit
PRINTSiPR00722 CHYMOTRYPSIN
SMARTiView protein in SMART
SM00202 SR, 1 hit
SM00020 Tryp_SPc, 1 hit
SUPFAMiSSF50494 SSF50494, 1 hit
SSF56487 SSF56487, 1 hit
PROSITEiView protein in PROSITE
PS50287 SRCR_2, 1 hit
PS50240 TRYPSIN_DOM, 1 hit
PS00134 TRYPSIN_HIS, 1 hit
PS00135 TRYPSIN_SER, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTMPSD_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BYE2
Secondary accession number(s): B4DTM9
, E9PIJ5, E9PRA0, F8WAJ3, J3KQC6, Q1RMF8, Q86YM4, Q96JY8, Q9BYE1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 15, 2005
Last sequence update: April 10, 2019
Last modified: October 16, 2019
This is version 143 of the entry and version 5 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again