Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Angiopoietin-related protein 4

Gene

ANGPTL4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Protein with hypoxia-induced expression in endothelial cells. May act as a regulator of angiogenesis and modulate tumorigenesis. Inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage. May exert a protective function on endothelial cells through an endocrine action. It is directly involved in regulating glucose homeostasis, lipid metabolism, and insulin sensitivity. In response to hypoxia, the unprocessed form of the protein accumulates in the subendothelial extracellular matrix (ECM). The matrix-associated and immobilized unprocessed form limits the formation of actin stress fibers and focal contacts in the adhering endothelial cells and inhibits their adhesion. It also decreases motility of endothelial cells and inhibits the sprouting and tube formation (By similarity).By similarity2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • enzyme inhibitor activity Source: UniProtKB
  • identical protein binding Source: IntAct

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processAngiogenesis, Differentiation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1989781 PPARA activates gene expression
R-HSA-381340 Transcriptional regulation of white adipocyte differentiation
R-HSA-8963889 Assembly of active LPL and LIPC lipase complexes

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Angiopoietin-related protein 4
Alternative name(s):
Angiopoietin-like protein 4
Hepatic fibrinogen/angiopoietin-related protein
Short name:
HFARP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ANGPTL4
Synonyms:ARP4, HFARP, PGAR
ORF Names:PP1158, PSEC0166, UNQ171/PRO197
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000167772.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:16039 ANGPTL4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605910 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BY76

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Extracellular matrix, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
51129

MalaCards human disease database

More...
MalaCardsi
ANGPTL4
MIMi615881 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000167772

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA24797

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ANGPTL4

Domain mapping of disease mutations (DMDM)

More...
DMDMi
25008123

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 25Sequence analysisAdd BLAST25
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000912426 – 406Angiopoietin-related protein 4Add BLAST381

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi177N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi188 ↔ 216PROSITE-ProRule annotation
Disulfide bondi341 ↔ 354PROSITE-ProRule annotation

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N-glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9BY76

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9BY76

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9BY76

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BY76

PeptideAtlas

More...
PeptideAtlasi
Q9BY76

PRoteomics IDEntifications database

More...
PRIDEi
Q9BY76

ProteomicsDB human proteome resource

More...
ProteomicsDBi
79597

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1918

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BY76

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BY76

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed at high levels in the placenta, heart, liver, muscle, pancreas and lung but expressed poorly in the brain and kidney.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000167772 Expressed in 178 organ(s), highest expression level in layer of synovial tissue

CleanEx database of gene expression profiles

More...
CleanExi
HS_ANGPTL4

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9BY76 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BY76 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB033770
HPA007879

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homooligomer. The homooligomer undergoes proteolytic processing to release its carboxyl fibrinogen-like domain, which circulates as a monomer. The homooligomer unprocessed form is able to interact with the extracellular matrix (By similarity).By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119316, 21 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9BY76

Protein interaction database and analysis system

More...
IntActi
Q9BY76, 16 interactors

Molecular INTeraction database

More...
MINTi
Q9BY76

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000301455

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1406
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6EUBX-ray2.30A184-406[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9BY76

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9BY76

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini179 – 401Fibrinogen C-terminalPROSITE-ProRule annotationAdd BLAST223

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili100 – 143Sequence analysisAdd BLAST44

Keywords - Domaini

Coiled coil, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2579 Eukaryota
ENOG410ZYS4 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159478

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000015386

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG001644

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BY76

KEGG Orthology (KO)

More...
KOi
K08767

Identification of Orthologs from Complete Genome Data

More...
OMAi
PKQRHQR

Database of Orthologous Groups

More...
OrthoDBi
357340at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BY76

TreeFam database of animal gene trees

More...
TreeFami
TF329953

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00087 FReD, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR028793 ANGPTL4
IPR036056 Fibrinogen-like_C
IPR002181 Fibrinogen_a/b/g_C_dom
IPR020837 Fibrinogen_CS

The PANTHER Classification System

More...
PANTHERi
PTHR19143:SF256 PTHR19143:SF256, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00147 Fibrinogen_C, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00186 FBG, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56496 SSF56496, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00514 FIBRINOGEN_C_1, 1 hit
PS51406 FIBRINOGEN_C_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BY76-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSGAPTAGAA LMLCAATAVL LSAQGGPVQS KSPRFASWDE MNVLAHGLLQ
60 70 80 90 100
LGQGLREHAE RTRSQLSALE RRLSACGSAC QGTEGSTDLP LAPESRVDPE
110 120 130 140 150
VLHSLQTQLK AQNSRIQQLF HKVAQQQRHL EKQHLRIQHL QSQFGLLDHK
160 170 180 190 200
HLDHEVAKPA RRKRLPEMAQ PVDPAHNVSR LHRLPRDCQE LFQVGERQSG
210 220 230 240 250
LFEIQPQGSP PFLVNCKMTS DGGWTVIQRR HDGSVDFNRP WEAYKAGFGD
260 270 280 290 300
PHGEFWLGLE KVHSITGDRN SRLAVQLRDW DGNAELLQFS VHLGGEDTAY
310 320 330 340 350
SLQLTAPVAG QLGATTVPPS GLSVPFSTWD QDHDLRRDKN CAKSLSGGWW
360 370 380 390 400
FGTCSHSNLN GQYFRSIPQQ RQKLKKGIFW KTWRGRYYPL QATTMLIQPM

AAEAAS
Length:406
Mass (Da):45,214
Last modified:November 8, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i219E56FEB3F602AF
GO
Isoform 2 (identifier: Q9BY76-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     183-221: RLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSD → H

Note: Gene prediction based on EST data.
Show »
Length:368
Mass (Da):40,917
Checksum:i7D61B5306C3AF298
GO
Isoform 3 (identifier: Q9BY76-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-167: Missing.

Note: No experimental confirmation available.
Show »
Length:239
Mass (Da):26,853
Checksum:iFBB362F2DBDB6900
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M0R2X8M0R2X8_HUMAN
Angiopoietin-related protein 4
ANGPTL4
129Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R369M0R369_HUMAN
Angiopoietin-related protein 4
ANGPTL4
128Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R0N8M0R0N8_HUMAN
Angiopoietin-related protein 4
ANGPTL4
85Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R3A2M0R3A2_HUMAN
Angiopoietin-related protein 4
ANGPTL4
104Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QZ51M0QZ51_HUMAN
Angiopoietin-related protein 4
ANGPTL4
96Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAQ88642 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti55 – 71LREHA…SALER → CANTGAHPQSAERAGA in AAD41088 (Ref. 5) CuratedAdd BLAST17
Sequence conflicti60E → G in BAB40692 (PubMed:14583458).Curated1
Sequence conflicti175A → P in AAF62868 (PubMed:10698685).Curated1
Sequence conflicti237F → S in BAG64351 (PubMed:14702039).Curated1
Sequence conflicti251P → S in BAD96209 (Ref. 8) Curated1
Sequence conflicti270N → D (PubMed:14702039).Curated1
Sequence conflicti270N → D (Ref. 8) Curated1
Sequence conflicti277L → R in BAD96244 (Ref. 8) Curated1
Sequence conflicti304L → F in AAF62868 (PubMed:10698685).Curated1
Sequence conflicti363Y → H in BAD96209 (Ref. 8) Curated1
Sequence conflicti389P → S in AAF62868 (PubMed:10698685).Curated1

<p>This subsection of the ‘Sequence’ section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement_in_disease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

Genetic variations in ANGPTL4 are associated with low plasma triglyceride levels and define the plasma triglyceride level quantitative trait locus (TGQTL) [MIMi:615881].1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0326425P → L1 PublicationCorresponds to variant dbSNP:rs761583091Ensembl.1
Natural variantiVAR_03264340E → K Associated with lower plasma levels of triglyceride and higher levels of HDL cholesterol. 1 PublicationCorresponds to variant dbSNP:rs116843064EnsemblClinVar.1
Natural variantiVAR_03264441M → I1 PublicationCorresponds to variant dbSNP:rs186754194Ensembl.1
Natural variantiVAR_03264567S → R1 PublicationCorresponds to variant dbSNP:rs538554190Ensembl.1
Natural variantiVAR_03264672R → L1 PublicationCorresponds to variant dbSNP:rs141831018Ensembl.1
Natural variantiVAR_03264777G → R1 PublicationCorresponds to variant dbSNP:rs568624939Ensembl.1
Natural variantiVAR_032648167E → K1 PublicationCorresponds to variant dbSNP:rs140640857Ensembl.1
Natural variantiVAR_032649174P → S1 PublicationCorresponds to variant dbSNP:rs1008363865Ensembl.1
Natural variantiVAR_032650190E → Q1 PublicationCorresponds to variant dbSNP:rs77938377Ensembl.1
Natural variantiVAR_032651196E → K1 PublicationCorresponds to variant dbSNP:rs1192364228Ensembl.1
Natural variantiVAR_032652230R → C1 PublicationCorresponds to variant dbSNP:rs201026877Ensembl.1
Natural variantiVAR_032653233G → R1 Publication1
Natural variantiVAR_032654237F → V1 PublicationCorresponds to variant dbSNP:rs768374046Ensembl.1
Natural variantiVAR_032655251P → T1 PublicationCorresponds to variant dbSNP:rs376328756Ensembl.1
Natural variantiVAR_020428266T → M3 PublicationsCorresponds to variant dbSNP:rs1044250Ensembl.1
Natural variantiVAR_032656278R → Q1 PublicationCorresponds to variant dbSNP:rs35061979Ensembl.1
Natural variantiVAR_032657291V → M1 PublicationCorresponds to variant dbSNP:rs150000287Ensembl.1
Natural variantiVAR_032658293L → M1 PublicationCorresponds to variant dbSNP:rs775667046Ensembl.1
Natural variantiVAR_032659296E → V1 Publication1
Natural variantiVAR_032660307P → S1 PublicationCorresponds to variant dbSNP:rs751249880Ensembl.1
Natural variantiVAR_032661308V → M1 PublicationCorresponds to variant dbSNP:rs139998264Ensembl.1
Natural variantiVAR_032662336R → C1 PublicationCorresponds to variant dbSNP:rs140744493Ensembl.1
Natural variantiVAR_032663338D → E1 PublicationCorresponds to variant dbSNP:rs780121474Ensembl.1
Natural variantiVAR_032664349W → C1 PublicationCorresponds to variant dbSNP:rs1033145581Ensembl.1
Natural variantiVAR_032665361G → R1 PublicationCorresponds to variant dbSNP:rs755737249Ensembl.1
Natural variantiVAR_032666361G → S1 PublicationCorresponds to variant dbSNP:rs755737249Ensembl.1
Natural variantiVAR_032667371R → Q1 PublicationCorresponds to variant dbSNP:rs779488814Ensembl.1
Natural variantiVAR_032668384R → W1 PublicationCorresponds to variant dbSNP:rs146942305Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0550921 – 167Missing in isoform 3. 1 PublicationAdd BLAST167
Alternative sequenceiVSP_047045183 – 221RLPRD…KMTSD → H in isoform 2. CuratedAdd BLAST39

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF169312 mRNA Translation: AAF62868.1
AF202636 mRNA Translation: AAG22490.1
AB056477 mRNA Translation: BAB40692.1
AF153606 mRNA Translation: AAD41088.1
AY358275 mRNA Translation: AAQ88642.1 Different initiation.
AK303269 mRNA Translation: BAG64351.1
AK222489 mRNA Translation: BAD96209.1
AK222524 mRNA Translation: BAD96244.1
AC136469 Genomic DNA No translation available.
CH471139 Genomic DNA Translation: EAW68930.1
CH471139 Genomic DNA Translation: EAW68931.1
BC023647 mRNA Translation: AAH23647.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS12200.1 [Q9BY76-1]
CCDS42493.1 [Q9BY76-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001034756.1, NM_001039667.2 [Q9BY76-2]
NP_647475.1, NM_139314.2 [Q9BY76-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.9613

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000301455; ENSP00000301455; ENSG00000167772 [Q9BY76-1]
ENST00000393962; ENSP00000377534; ENSG00000167772 [Q9BY76-2]
ENST00000593998; ENSP00000472551; ENSG00000167772 [Q9BY76-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51129

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51129

UCSC genome browser

More...
UCSCi
uc002mjq.3 human [Q9BY76-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF169312 mRNA Translation: AAF62868.1
AF202636 mRNA Translation: AAG22490.1
AB056477 mRNA Translation: BAB40692.1
AF153606 mRNA Translation: AAD41088.1
AY358275 mRNA Translation: AAQ88642.1 Different initiation.
AK303269 mRNA Translation: BAG64351.1
AK222489 mRNA Translation: BAD96209.1
AK222524 mRNA Translation: BAD96244.1
AC136469 Genomic DNA No translation available.
CH471139 Genomic DNA Translation: EAW68930.1
CH471139 Genomic DNA Translation: EAW68931.1
BC023647 mRNA Translation: AAH23647.1
CCDSiCCDS12200.1 [Q9BY76-1]
CCDS42493.1 [Q9BY76-2]
RefSeqiNP_001034756.1, NM_001039667.2 [Q9BY76-2]
NP_647475.1, NM_139314.2 [Q9BY76-1]
UniGeneiHs.9613

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6EUBX-ray2.30A184-406[»]
ProteinModelPortaliQ9BY76
SMRiQ9BY76
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119316, 21 interactors
CORUMiQ9BY76
IntActiQ9BY76, 16 interactors
MINTiQ9BY76
STRINGi9606.ENSP00000301455

PTM databases

GlyConnecti1918
iPTMnetiQ9BY76
PhosphoSitePlusiQ9BY76

Polymorphism and mutation databases

BioMutaiANGPTL4
DMDMi25008123

Proteomic databases

EPDiQ9BY76
jPOSTiQ9BY76
MaxQBiQ9BY76
PaxDbiQ9BY76
PeptideAtlasiQ9BY76
PRIDEiQ9BY76
ProteomicsDBi79597

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
51129
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000301455; ENSP00000301455; ENSG00000167772 [Q9BY76-1]
ENST00000393962; ENSP00000377534; ENSG00000167772 [Q9BY76-2]
ENST00000593998; ENSP00000472551; ENSG00000167772 [Q9BY76-1]
GeneIDi51129
KEGGihsa:51129
UCSCiuc002mjq.3 human [Q9BY76-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51129
DisGeNETi51129
EuPathDBiHostDB:ENSG00000167772.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ANGPTL4
HGNCiHGNC:16039 ANGPTL4
HPAiCAB033770
HPA007879
MalaCardsiANGPTL4
MIMi605910 gene
615881 phenotype
neXtProtiNX_Q9BY76
OpenTargetsiENSG00000167772
PharmGKBiPA24797

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2579 Eukaryota
ENOG410ZYS4 LUCA
GeneTreeiENSGT00940000159478
HOGENOMiHOG000015386
HOVERGENiHBG001644
InParanoidiQ9BY76
KOiK08767
OMAiPKQRHQR
OrthoDBi357340at2759
PhylomeDBiQ9BY76
TreeFamiTF329953

Enzyme and pathway databases

ReactomeiR-HSA-1989781 PPARA activates gene expression
R-HSA-381340 Transcriptional regulation of white adipocyte differentiation
R-HSA-8963889 Assembly of active LPL and LIPC lipase complexes

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ANGPTL4 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ANGPTL4

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51129

Protein Ontology

More...
PROi
PR:Q9BY76

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000167772 Expressed in 178 organ(s), highest expression level in layer of synovial tissue
CleanExiHS_ANGPTL4
ExpressionAtlasiQ9BY76 baseline and differential
GenevisibleiQ9BY76 HS

Family and domain databases

CDDicd00087 FReD, 1 hit
InterProiView protein in InterPro
IPR028793 ANGPTL4
IPR036056 Fibrinogen-like_C
IPR002181 Fibrinogen_a/b/g_C_dom
IPR020837 Fibrinogen_CS
PANTHERiPTHR19143:SF256 PTHR19143:SF256, 1 hit
PfamiView protein in Pfam
PF00147 Fibrinogen_C, 1 hit
SMARTiView protein in SMART
SM00186 FBG, 1 hit
SUPFAMiSSF56496 SSF56496, 1 hit
PROSITEiView protein in PROSITE
PS00514 FIBRINOGEN_C_1, 1 hit
PS51406 FIBRINOGEN_C_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiANGL4_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BY76
Secondary accession number(s): A8MY84
, B4E089, D6W670, F5H0I2, Q53HQ6, Q53HU1, Q6UXN0, Q9HBV4, Q9NZU4, Q9Y5B3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 8, 2002
Last sequence update: November 8, 2002
Last modified: January 16, 2019
This is version 164 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again