Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 174 (16 Oct 2019)
Sequence version 2 (24 Oct 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Lysine-specific demethylase 5D

Gene

KDM5D

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Histone demethylase that specifically demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9', H3 'Lys-27', H3 'Lys-36', H3 'Lys-79' or H4 'Lys-20'. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-4'. May play a role in spermatogenesis. Involved in transcriptional repression of diverse metastasis-associated genes; in this function seems to cooperate with ZMYND8. Suppresses prostate cancer cell invasion. Regulates androgen receptor (AR) transcriptional activity by demethylating H3K4me3 active transcription marks.7 Publications

Miscellaneous

Involved in sensitivity to docetaxel.1 Publication

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Protein has several cofactor binding sites:

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

Kcat are 2.6 min(-1) and 3.0 min(-1) for 2-oxoglutarate and histone H3K4me3, respectively.1 Publication
  1. KM=10 µM for 2-oxoglutarate1 Publication
  2. KM=6.2 µM for histone H3K4me31 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei4302-oxoglutarateBy similarity1
    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi504Iron; catalyticPROSITE-ProRule annotation1
    Metal bindingi506Iron; catalyticBy similarity1
    Binding sitei5122-oxoglutarateBy similarity1
    Binding sitei5142-oxoglutarateBy similarity1
    Binding sitei5222-oxoglutarateBy similarity1
    Metal bindingi592Iron; catalyticPROSITE-ProRule annotation1

    Regions

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri316 – 362PHD-type 1PROSITE-ProRule annotationAdd BLAST47
    Zinc fingeri697 – 749C5HC2By similarityAdd BLAST53
    Zinc fingeri1174 – 1235PHD-type 2PROSITE-ProRule annotationAdd BLAST62

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionChromatin regulator, Dioxygenase, Oxidoreductase
    Biological processTranscription, Transcription regulation
    LigandIron, Metal-binding, Zinc

    Enzyme and pathway databases

    Reactome - a knowledgebase of biological pathways and processes

    More...
    Reactomei
    R-HSA-3214842 HDMs demethylate histones

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Lysine-specific demethylase 5D (EC:1.14.11.-)
    Alternative name(s):
    Histocompatibility Y antigen
    Short name:
    H-Y
    Histone demethylase JARID1D
    Jumonji/ARID domain-containing protein 1D
    Protein SmcY
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:KDM5D
    Synonyms:HY, HYA, JARID1D, KIAA0234, SMCY
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome Y

    Organism-specific databases

    Human Gene Nomenclature Database

    More...
    HGNCi
    HGNC:11115 KDM5D

    Online Mendelian Inheritance in Man (OMIM)

    More...
    MIMi
    426000 gene

    neXtProt; the human protein knowledge platform

    More...
    neXtProti
    NX_Q9BY66

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Nucleus

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi534H → A: Abolishes enzymatic activity; when associated with A-536. 1 Publication1
    Mutagenesisi536E → A: Abolishes enzymatic activity; when associated with A-534. 1 Publication1

    Organism-specific databases

    DisGeNET

    More...
    DisGeNETi
    8284

    GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

    More...
    GeneReviewsi
    KDM5D

    MalaCards human disease database

    More...
    MalaCardsi
    KDM5D

    Open Targets

    More...
    OpenTargetsi
    ENSG00000012817

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...
    PharmGKBi
    PA35965

    Miscellaneous databases

    Pharos NIH Druggable Genome Knowledgebase

    More...
    Pharosi
    Q9BY66

    Chemistry databases

    Drug and drug target database

    More...
    DrugBanki
    DB00126 Ascorbic acid

    Polymorphism and mutation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...
    BioMutai
    KDM5D

    Domain mapping of disease mutations (DMDM)

    More...
    DMDMi
    17368706

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002005881 – 1539Lysine-specific demethylase 5DAdd BLAST1539

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki205Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
    Cross-linki229Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
    Cross-linki244Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
    Cross-linki272Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
    <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei291PhosphoserineBy similarity1
    Modified residuei307PhosphoserineBy similarity1
    Modified residuei884PhosphoserineBy similarity1
    Modified residuei1346PhosphoserineBy similarity1

    Keywords - PTMi

    Isopeptide bond, Phosphoprotein, Ubl conjugation

    Proteomic databases

    jPOST - Japan Proteome Standard Repository/Database

    More...
    jPOSTi
    Q9BY66

    MassIVE - Mass Spectrometry Interactive Virtual Environment

    More...
    MassIVEi
    Q9BY66

    MaxQB - The MaxQuant DataBase

    More...
    MaxQBi
    Q9BY66

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    Q9BY66

    PeptideAtlas

    More...
    PeptideAtlasi
    Q9BY66

    PRoteomics IDEntifications database

    More...
    PRIDEi
    Q9BY66

    ProteomicsDB: a multi-organism proteome resource

    More...
    ProteomicsDBi
    79591 [Q9BY66-1]
    79592 [Q9BY66-2]
    79593 [Q9BY66-3]

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    Q9BY66

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    Q9BY66

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Expression is highly down-regulated in metastatic prostate tumors.1 Publication

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSG00000012817 Expressed in 199 organ(s), highest expression level in left adrenal gland

    ExpressionAtlas, Differential and Baseline Expression

    More...
    ExpressionAtlasi
    Q9BY66 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    Q9BY66 HS

    Organism-specific databases

    Human Protein Atlas

    More...
    HPAi
    HPA049086

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Interacts with PCGF6, MSH5, ZMYND8, AR.

    4 Publications

    <p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

    WithEntry#Exp.IntActNotes
    ARP102752EBI-12559887,EBI-608057

    GO - Molecular functioni

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...
    BioGridi
    113891, 3 interactors

    Protein interaction database and analysis system

    More...
    IntActi
    Q9BY66, 3 interactors

    Chemistry databases

    BindingDB database of measured binding affinities

    More...
    BindingDBi
    Q9BY66

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    Secondary structure

    11539
    Legend: HelixTurnBeta strandPDB Structure known for this area
    Show more details

    3D structure databases

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...
    SMRi
    Q9BY66

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    Protein Data Bank in Europe - Knowledge Base

    More...
    PDBe-KBi
    Search...

    Miscellaneous databases

    Relative evolutionary importance of amino acids within a protein sequence

    More...
    EvolutionaryTracei
    Q9BY66

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini14 – 55JmjNPROSITE-ProRule annotationAdd BLAST42
    Domaini79 – 169ARIDPROSITE-ProRule annotationAdd BLAST91
    Domaini458 – 624JmjCPROSITE-ProRule annotationAdd BLAST167

    <p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

    The JmjC domain is required for enzymatic activity.

    <p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Belongs to the JARID1 histone demethylase family.Curated

    Zinc finger

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Zinc fingeri316 – 362PHD-type 1PROSITE-ProRule annotationAdd BLAST47
    Zinc fingeri697 – 749C5HC2By similarityAdd BLAST53
    Zinc fingeri1174 – 1235PHD-type 2PROSITE-ProRule annotationAdd BLAST62

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG1246 Eukaryota
    ENOG410XR9J LUCA

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00940000161236

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...
    HOGENOMi
    HOG000290719

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    Q9BY66

    KEGG Orthology (KO)

    More...
    KOi
    K11446

    Identification of Orthologs from Complete Genome Data

    More...
    OMAi
    EACISQV

    Database of Orthologous Groups

    More...
    OrthoDBi
    664180at2759

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    Q9BY66

    TreeFam database of animal gene trees

    More...
    TreeFami
    TF106476

    Family and domain databases

    Gene3D Structural and Functional Annotation of Protein Families

    More...
    Gene3Di
    1.10.150.60, 1 hit
    3.30.40.10, 1 hit

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR001606 ARID_dom
    IPR036431 ARID_dom_sf
    IPR003347 JmjC_dom
    IPR003349 JmjN
    IPR013637 Lys_sp_deMease-like_dom
    IPR019786 Zinc_finger_PHD-type_CS
    IPR004198 Znf_C5HC2
    IPR011011 Znf_FYVE_PHD
    IPR001965 Znf_PHD
    IPR019787 Znf_PHD-finger
    IPR013083 Znf_RING/FYVE/PHD

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF01388 ARID, 1 hit
    PF02373 JmjC, 1 hit
    PF02375 JmjN, 1 hit
    PF00628 PHD, 1 hit
    PF08429 PLU-1, 1 hit
    PF02928 zf-C5HC2, 1 hit

    Simple Modular Architecture Research Tool; a protein domain database

    More...
    SMARTi
    View protein in SMART
    SM00501 BRIGHT, 1 hit
    SM00558 JmjC, 1 hit
    SM00545 JmjN, 1 hit
    SM00249 PHD, 2 hits

    Superfamily database of structural and functional annotation

    More...
    SUPFAMi
    SSF46774 SSF46774, 1 hit
    SSF57903 SSF57903, 2 hits

    PROSITE; a protein domain and family database

    More...
    PROSITEi
    View protein in PROSITE
    PS51011 ARID, 1 hit
    PS51184 JMJC, 1 hit
    PS51183 JMJN, 1 hit
    PS01359 ZF_PHD_1, 2 hits
    PS50016 ZF_PHD_2, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
    Note: Additional isoforms seem to exist.

    This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: Q9BY66-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MEPGCDEFLP PPECPVFEPS WAEFQDPLGY IAKIRPIAEK SGICKIRPPA
    60 70 80 90 100
    DWQPPFAVEV DNFRFTPRVQ RLNELEAQTR VKLNYLDQIA KFWEIQGSSL
    110 120 130 140 150
    KIPNVERKIL DLYSLSKIVI EEGGYEAICK DRRWARVAQR LHYPPGKNIG
    160 170 180 190 200
    SLLRSHYERI IYPYEMFQSG ANHVQCNTHP FDNEVKDKEY KPHSIPLRQS
    210 220 230 240 250
    VQPSKFSSYS RRAKRLQPDP EPTEEDIEKH PELKKLQIYG PGPKMMGLGL
    260 270 280 290 300
    MAKDKDKTVH KKVTCPPTVT VKDEQSGGGN VSSTLLKQHL SLEPCTKTTM
    310 320 330 340 350
    QLRKNHSSAQ FIDSYICQVC SRGDEDDKLL FCDGCDDNYH IFCLLPPLPE
    360 370 380 390 400
    IPRGIWRCPK CILAECKQPP EAFGFEQATQ EYSLQSFGEM ADSFKSDYFN
    410 420 430 440 450
    MPVHMVPTEL VEKEFWRLVS SIEEDVTVEY GADIHSKEFG SGFPVSNSKQ
    460 470 480 490 500
    NLSPEEKEYA TSGWNLNVMP VLDQSVLCHI NADISGMKVP WLYVGMVFSA
    510 520 530 540 550
    FCWHIEDHWS YSINYLHWGE PKTWYGVPSL AAEHLEEVMK MLTPELFDSQ
    560 570 580 590 600
    PDLLHQLVTL MNPNTLMSHG VPVVRTNQCA GEFVITFPRA YHSGFNQGYN
    610 620 630 640 650
    FAEAVNFCTA DWLPAGRQCI EHYRRLRRYC VFSHEELICK MAAFPETLDL
    660 670 680 690 700
    NLAVAVHKEM FIMVQEERRL RKALLEKGVT EAEREAFELL PDDERQCIKC
    710 720 730 740 750
    KTTCFLSALA CYDCPDGLVC LSHINDLCKC SSSRQYLRYR YTLDELPTML
    760 770 780 790 800
    HKLKIRAESF DTWANKVRVA LEVEDGRKRS FEELRALESE ARERRFPNSE
    810 820 830 840 850
    LLQRLKNCLS EVEACIAQVL GLVSGQVARM DTPQLTLTEL RVLLEQMGSL
    860 870 880 890 900
    PCAMHQIGDV KDVLEQVEAY QAEAREALAT LPSSPGLLRS LLERGQQLGV
    910 920 930 940 950
    EVPEAHQLQQ QVEQAQWLDE VKQALAPSAH RGSLVIMQGL LVMGAKIASS
    960 970 980 990 1000
    PSVDKARAEL QELLTIAERW EEKAHFCLEA RQKHPPATLE AIIRETENIP
    1010 1020 1030 1040 1050
    VHLPNIQALK EALTKAQAWI ADVDEIQNGD HYPCLDDLEG LVAVGRDLPV
    1060 1070 1080 1090 1100
    GLEELRQLEL QVLTAHSWRE KASKTFLKKN SCYTLLEVLC PCADAGSDST
    1110 1120 1130 1140 1150
    KRSRWMEKAL GLYQCDTELL GLSAQDLRDP GSVIVAFKEG EQKEKEGILQ
    1160 1170 1180 1190 1200
    LRRTNSAKPS PLAPSLMASS PTSICVCGQV PAGVGVLQCD LCQDWFHGQC
    1210 1220 1230 1240 1250
    VSVPHLLTSP KPSLTSSPLL AWWEWDTKFL CPLCMRSRRP RLETILALLV
    1260 1270 1280 1290 1300
    ALQRLPVRLP EGEALQCLTE RAIGWQDRAR KALASEDVTA LLRQLAELRQ
    1310 1320 1330 1340 1350
    QLQAKPRPEE ASVYTSATAC DPIREGSGNN ISKVQGLLEN GDSVTSPENM
    1360 1370 1380 1390 1400
    APGKGSDLEL LSSLLPQLTG PVLELPEAIR APLEELMMEG DLLEVTLDEN
    1410 1420 1430 1440 1450
    HSIWQLLQAG QPPDLDRIRT LLELEKFEHQ GSRTRSRALE RRRRRQKVDQ
    1460 1470 1480 1490 1500
    GRNVENLVQQ ELQSKRARSS GIMSQVGREE EHYQEKADRE NMFLTPSTDH
    1510 1520 1530
    SPFLKGNQNS LQHKDSGSSA ACPSLMPLLQ LSYSDEQQL
    Length:1,539
    Mass (Da):174,073
    Last modified:October 24, 2001 - v2
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE58DAE374E3BD7AA
    GO
    Isoform 2 (identifier: Q9BY66-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         118-174: Missing.

    Show »
    Length:1,482
    Mass (Da):167,401
    Checksum:iF1A41999427CA63D
    GO
    Isoform 3 (identifier: Q9BY66-3) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         457-457: K → KRQSLTVLTRLISSFWAQAVLPPWPPKVLGLQ

    Note: No experimental confirmation available.
    Show »
    Length:1,570
    Mass (Da):177,558
    Checksum:i364A4C31873A1D57
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    E9PFH2E9PFH2_HUMAN
    Lysine-specific demethylase 5D
    KDM5D
    1,476Annotation score:

    Annotation score:2 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    C9JGA3C9JGA3_HUMAN
    Lysine-specific demethylase 5D
    KDM5D
    425Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    H7BZF9H7BZF9_HUMAN
    Lysine-specific demethylase 5D
    KDM5D
    293Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    <p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

    The sequence BAA13241 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti327D → N in AAC50806 (PubMed:8841177).Curated1
    Sequence conflicti327D → N in AAC51135 (PubMed:9060413).Curated1
    Sequence conflicti1285S → F in AAC50806 (PubMed:8841177).Curated1
    Sequence conflicti1352P → L in AAK27839 (Ref. 8) Curated1
    Sequence conflicti1391D → G in AAC50806 (PubMed:8841177).Curated1

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0329911186V → L1 PublicationCorresponds to variant dbSNP:rs1050807Ensembl.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_000317118 – 174Missing in isoform 2. 2 PublicationsAdd BLAST57
    Alternative sequenceiVSP_043320457K → KRQSLTVLTRLISSFWAQAV LPPWPPKVLGLQ in isoform 3. 1 Publication1

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    U52191 mRNA Translation: AAC50806.1
    D87072 mRNA Translation: BAA13241.2 Different initiation.
    AF273841 Genomic DNA Translation: AAG00951.1
    AC010889 Genomic DNA No translation available.
    CH471202 Genomic DNA Translation: EAW54663.1
    BC132721 mRNA Translation: AAI32722.1
    BC144102 mRNA Translation: AAI44103.1
    BC146767 mRNA Translation: AAI46768.1
    U52365 mRNA Translation: AAC51135.1
    AF134849 Genomic DNA Translation: AAK27839.1

    The Consensus CDS (CCDS) project

    More...
    CCDSi
    CCDS14794.1 [Q9BY66-1]
    CCDS55554.1 [Q9BY66-2]
    CCDS55555.1 [Q9BY66-3]

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_001140177.1, NM_001146705.1 [Q9BY66-3]
    NP_001140178.1, NM_001146706.1 [Q9BY66-2]
    NP_004644.2, NM_004653.4 [Q9BY66-1]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENST00000317961; ENSP00000322408; ENSG00000012817 [Q9BY66-1]
    ENST00000382806; ENSP00000372256; ENSG00000012817 [Q9BY66-2]
    ENST00000541639; ENSP00000444293; ENSG00000012817 [Q9BY66-3]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    8284

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    hsa:8284

    UCSC genome browser

    More...
    UCSCi
    uc004fug.4 human [Q9BY66-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    U52191 mRNA Translation: AAC50806.1
    D87072 mRNA Translation: BAA13241.2 Different initiation.
    AF273841 Genomic DNA Translation: AAG00951.1
    AC010889 Genomic DNA No translation available.
    CH471202 Genomic DNA Translation: EAW54663.1
    BC132721 mRNA Translation: AAI32722.1
    BC144102 mRNA Translation: AAI44103.1
    BC146767 mRNA Translation: AAI46768.1
    U52365 mRNA Translation: AAC51135.1
    AF134849 Genomic DNA Translation: AAK27839.1
    CCDSiCCDS14794.1 [Q9BY66-1]
    CCDS55554.1 [Q9BY66-2]
    CCDS55555.1 [Q9BY66-3]
    RefSeqiNP_001140177.1, NM_001146705.1 [Q9BY66-3]
    NP_001140178.1, NM_001146706.1 [Q9BY66-2]
    NP_004644.2, NM_004653.4 [Q9BY66-1]

    3D structure databases

    Select the link destinations:

    Protein Data Bank Europe

    More...
    PDBei

    Protein Data Bank RCSB

    More...
    RCSB PDBi

    Protein Data Bank Japan

    More...
    PDBji
    Links Updated
    PDB entryMethodResolution (Å)ChainPositionsPDBsum
    2E6RNMR-A306-384[»]
    2YQENMR-A79-171[»]
    SMRiQ9BY66
    ModBaseiSearch...
    PDBe-KBiSearch...

    Protein-protein interaction databases

    BioGridi113891, 3 interactors
    IntActiQ9BY66, 3 interactors

    Chemistry databases

    BindingDBiQ9BY66
    DrugBankiDB00126 Ascorbic acid

    PTM databases

    iPTMnetiQ9BY66
    PhosphoSitePlusiQ9BY66

    Polymorphism and mutation databases

    BioMutaiKDM5D
    DMDMi17368706

    Proteomic databases

    jPOSTiQ9BY66
    MassIVEiQ9BY66
    MaxQBiQ9BY66
    PaxDbiQ9BY66
    PeptideAtlasiQ9BY66
    PRIDEiQ9BY66
    ProteomicsDBi79591 [Q9BY66-1]
    79592 [Q9BY66-2]
    79593 [Q9BY66-3]

    Genome annotation databases

    EnsembliENST00000317961; ENSP00000322408; ENSG00000012817 [Q9BY66-1]
    ENST00000382806; ENSP00000372256; ENSG00000012817 [Q9BY66-2]
    ENST00000541639; ENSP00000444293; ENSG00000012817 [Q9BY66-3]
    GeneIDi8284
    KEGGihsa:8284
    UCSCiuc004fug.4 human [Q9BY66-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    8284
    DisGeNETi8284

    GeneCards: human genes, protein and diseases

    More...
    GeneCardsi
    KDM5D
    GeneReviewsiKDM5D
    HGNCiHGNC:11115 KDM5D
    HPAiHPA049086
    MalaCardsiKDM5D
    MIMi426000 gene
    neXtProtiNX_Q9BY66
    OpenTargetsiENSG00000012817
    PharmGKBiPA35965

    Human Unidentified Gene-Encoded large proteins database

    More...
    HUGEi
    Search...

    GenAtlas: human gene database

    More...
    GenAtlasi
    Search...

    Phylogenomic databases

    eggNOGiKOG1246 Eukaryota
    ENOG410XR9J LUCA
    GeneTreeiENSGT00940000161236
    HOGENOMiHOG000290719
    InParanoidiQ9BY66
    KOiK11446
    OMAiEACISQV
    OrthoDBi664180at2759
    PhylomeDBiQ9BY66
    TreeFamiTF106476

    Enzyme and pathway databases

    ReactomeiR-HSA-3214842 HDMs demethylate histones

    Miscellaneous databases

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...
    ChiTaRSi
    KDM5D human
    EvolutionaryTraceiQ9BY66

    The Gene Wiki collection of pages on human genes and proteins

    More...
    GeneWikii
    JARID1D

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...
    GenomeRNAii
    8284
    PharosiQ9BY66

    Protein Ontology

    More...
    PROi
    PR:Q9BY66

    The Stanford Online Universal Resource for Clones and ESTs

    More...
    SOURCEi
    Search...

    Gene expression databases

    BgeeiENSG00000012817 Expressed in 199 organ(s), highest expression level in left adrenal gland
    ExpressionAtlasiQ9BY66 baseline and differential
    GenevisibleiQ9BY66 HS

    Family and domain databases

    Gene3Di1.10.150.60, 1 hit
    3.30.40.10, 1 hit
    InterProiView protein in InterPro
    IPR001606 ARID_dom
    IPR036431 ARID_dom_sf
    IPR003347 JmjC_dom
    IPR003349 JmjN
    IPR013637 Lys_sp_deMease-like_dom
    IPR019786 Zinc_finger_PHD-type_CS
    IPR004198 Znf_C5HC2
    IPR011011 Znf_FYVE_PHD
    IPR001965 Znf_PHD
    IPR019787 Znf_PHD-finger
    IPR013083 Znf_RING/FYVE/PHD
    PfamiView protein in Pfam
    PF01388 ARID, 1 hit
    PF02373 JmjC, 1 hit
    PF02375 JmjN, 1 hit
    PF00628 PHD, 1 hit
    PF08429 PLU-1, 1 hit
    PF02928 zf-C5HC2, 1 hit
    SMARTiView protein in SMART
    SM00501 BRIGHT, 1 hit
    SM00558 JmjC, 1 hit
    SM00545 JmjN, 1 hit
    SM00249 PHD, 2 hits
    SUPFAMiSSF46774 SSF46774, 1 hit
    SSF57903 SSF57903, 2 hits
    PROSITEiView protein in PROSITE
    PS51011 ARID, 1 hit
    PS51184 JMJC, 1 hit
    PS51183 JMJN, 1 hit
    PS01359 ZF_PHD_1, 2 hits
    PS50016 ZF_PHD_2, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKDM5D_HUMAN
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BY66
    Secondary accession number(s): A2RU19
    , A6H8V7, B7ZLX1, Q92509, Q92809, Q9HCU1
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 24, 2001
    Last sequence update: October 24, 2001
    Last modified: October 16, 2019
    This is version 174 of the entry and version 2 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    2. SIMILARITY comments
      Index of protein domains and families
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. Human chromosome Y
      Human chromosome Y: entries, gene names and cross-references to MIM
    6. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again