Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q9BY43 (CHM4A_HUMAN)

Entry version 172 (12 Aug 2020)
Sequence version 3 (07 Feb 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Charged multivesicular body protein 4a

Gene

CHMP4A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. When overexpressed, membrane-assembled circular arrays of CHMP4A filaments can promote or stabilize negative curvature and outward budding. Via its interaction with PDCD6IP involved in HIV-1 p6- and p9-dependent virus release. CHMP4A/B/C are required for the exosomal release of SDCBP, CD63 and syndecan (PubMed:22660413).6 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processProtein transport, Transport
LigandLipid-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q9BY43

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-162588, Budding and maturation of HIV virion
R-HSA-1632852, Macroautophagy
R-HSA-917729, Endosomal Sorting Complex Required For Transport (ESCRT)
R-HSA-9610379, HCMV Late Events
R-HSA-9615710, Late endosomal microautophagy
R-HSA-9668328, Sealing of the nuclear envelope (NE) by ESCRT-III

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q9BY43

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Charged multivesicular body protein 4a
Alternative name(s):
Chromatin-modifying protein 4a
Short name:
CHMP4a
SNF7 homolog associated with Alix-2
SNF7-1
Short name:
hSnf-1
Vacuolar protein sorting-associated protein 32-1
Short name:
Vps32-1
Short name:
hVps32-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CHMP4A
Synonyms:C14orf123, SHAX2
ORF Names:CDA04, HSPC134
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000254505.9

Human Gene Nomenclature Database

More...HGNCi		HGNC:20274, CHMP4A

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		610051, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q9BY43

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasmic vesicle, Endosome, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi182 – 222Missing : Membrane association; releases autoinhibition. 1 PublicationAdd BLAST41
Mutagenesisi209E → A: Reduces interaction with PDCD6IP. 1 Publication1
Mutagenesisi214L → A: Abolishes interaction with PDCD6IP. 1 Publication1
Mutagenesisi217L → A: Abolishes interaction with PDCD6IP. 1 Publication1
Mutagenesisi220W → A: Abolishes interaction with PDCD6IP. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		29082

Open Targets

More...OpenTargetsi		ENSG00000254505

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134888743

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q9BY43, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CHMP4A

Domain mapping of disease mutations (DMDM)

More...DMDMi		90152096

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002114881 – 222Charged multivesicular body protein 4aAdd BLAST222

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei196PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q9BY43

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q9BY43

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q9BY43

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q9BY43

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q9BY43

PeptideAtlas

More...PeptideAtlasi		Q9BY43

PRoteomics IDEntifications database

More...PRIDEi		Q9BY43

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		60344
79580 [Q9BY43-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q9BY43

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q9BY43

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Expressed at higher level in heart, kidney, liver and skeletal muscle. Also expressed in brain, placenta, lung and pancreas.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000254505, Expressed in frontal cortex and 116 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q9BY43, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q9BY43, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000254505, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Probable core component of the endosomal sorting required for transport complex III (ESCRT-III). ESCRT-III components are thought to multimerize to form a flat lattice on the perimeter membrane of the endosome. Several assembly forms of ESCRT-III may exist that interact and act sequentially. Self-associates; overexpression leads to the assembly of filaments that curve and associate to create circular rings.

Interacts with CHMP2A.

Interacts with CHMP3; the interaction requires the release of CHMP4A autoinhibition.

Interacts with CHMP4B.

Interacts with CHMP4C.

Interacts with CHMP6.

Interacts with VPS4A.

Interacts with PDCD6IP; the interaction is direct.

8 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		118852, 51 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-329, ESCRT-III complex

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q9BY43

Database of interacting proteins

More...DIPi		DIP-39082N

Protein interaction database and analysis system

More...IntActi		Q9BY43, 25 interactors

Molecular INTeraction database

More...MINTi		Q9BY43

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000324205

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q9BY43, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1222
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q9BY43

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q9BY43

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 150Intramolecular interaction with C-terminusBy similarityAdd BLAST150
Regioni1 – 116Interaction with phosphoinosidesAdd BLAST116
Regioni151 – 222Intramolecular interaction with N-terminusBy similarityAdd BLAST72

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili20 – 105Sequence analysisAdd BLAST86
Coiled coili155 – 180Sequence analysisAdd BLAST26

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The acidic C-terminus and the basic N-termminus are thought to render the protein in a closed, soluble and inactive conformation through an autoinhibitory intramolecular interaction. The open and active conformation, which enables membrane binding and oligomerization, is achieved by interaction with other cellular binding partners, probably including other ESCRT components (By similarity).By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SNF7 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1656, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000163323

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_071097_0_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q9BY43

KEGG Orthology (KO)

More...KOi		K12194

Identification of Orthologs from Complete Genome Data

More...OMAi		KQEFLEH

Database of Orthologous Groups

More...OrthoDBi		1490465at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q9BY43

TreeFam database of animal gene trees

More...TreeFami		TF314269

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR005024, Snf7_fam

Pfam protein domain database

More...Pfami		View protein in Pfam
PF03357, Snf7, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BY43-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSGLGRLFGK GKKEKGPTPE EAIQKLKETE KILIKKQEFL EQKIQQELQT 
        60         70         80         90        100
AKKYGTKNKR AALQALRRKK RFEQQLAQTD GTLSTLEFQR EAIENATTNA 
       110        120        130        140        150
EVLRTMELAA QSMKKAYQDM DIDKVDELMT DITEQQEVAQ QISDAISRPM 
       160        170        180        190        200
GFGDDVDEDE LLEELEELEQ EELAQELLNV GDKEEEPSVK LPSVPSTHLP 
       210        220 
AGPAPKVDED EEALKQLAEW VS
Length:222
Mass (Da):25,098
Last modified:February 7, 2006 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6712BA6AAA1D7CB7
GO
Isoform 2 (identifier: Q9BY43-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSRRRPEDGLGKAGPCVMRHHPPRSKAEVWRTLRGGGGRGELAM

Show »
Length:265
Mass (Da):29,804
Checksum:i9F8805839882B9D1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PQ80E9PQ80_HUMAN
Charged multivesicular body protein...
CHMP4A
213Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PQI5E9PQI5_HUMAN
Charged multivesicular body protein...
CHMP4A
123Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YIN6H0YIN6_HUMAN
Charged multivesicular body protein...
CHMP4A
117Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YI89H0YI89_HUMAN
Charged multivesicular body protein...
CHMP4A
61Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH10893 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAI07700 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAD61949 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti16G → R in AAF29098 (PubMed:11042152).Curated1
Sequence conflicti66L → S in AAF29098 (PubMed:11042152).Curated1
Sequence conflicti152 – 153FG → LLE in AAF29098 (PubMed:11042152).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_023384153G → R2 PublicationsCorresponds to variant dbSNP:rs2295322Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0562641M → MSRRRPEDGLGKAGPCVMRH HPPRSKAEVWRTLRGGGGRG ELAM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB100262 mRNA Translation: BAC79376.2
AY329084 mRNA Translation: AAQ91193.1
AF212243 mRNA Translation: AAK14928.1
AF161483 mRNA Translation: AAF29098.1
BX161512 mRNA Translation: CAD61949.1 Different initiation.
AL096870 Genomic DNA No translation available.
AL136295 Genomic DNA No translation available.
BC010893 mRNA Translation: AAH10893.2 Different initiation.
BC107699 mRNA Translation: AAI07700.1 Different initiation.
BC113533 mRNA Translation: AAI13534.1
BC113535 mRNA Translation: AAI13536.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS9619.1 [Q9BY43-1]

NCBI Reference Sequences

More...RefSeqi		NP_054888.2, NM_014169.3 [Q9BY43-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000347519; ENSP00000324205; ENSG00000254505 [Q9BY43-1]
ENST00000645308; ENSP00000495982; ENSG00000285302 [Q9BY43-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		29082

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:29082

UCSC genome browser

More...UCSCi		uc001wni.4, human [Q9BY43-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB100262 mRNA Translation: BAC79376.2
AY329084 mRNA Translation: AAQ91193.1
AF212243 mRNA Translation: AAK14928.1
AF161483 mRNA Translation: AAF29098.1
BX161512 mRNA Translation: CAD61949.1 Different initiation.
AL096870 Genomic DNA No translation available.
AL136295 Genomic DNA No translation available.
BC010893 mRNA Translation: AAH10893.2 Different initiation.
BC107699 mRNA Translation: AAI07700.1 Different initiation.
BC113533 mRNA Translation: AAI13534.1
BC113535 mRNA Translation: AAI13536.1
CCDSiCCDS9619.1 [Q9BY43-1]
RefSeqiNP_054888.2, NM_014169.3 [Q9BY43-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3C3OX-ray2.15B210-222[»]
5MK1X-ray2.50E/F/H/K205-222[»]
SMRiQ9BY43
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi118852, 51 interactors
ComplexPortaliCPX-329, ESCRT-III complex
CORUMiQ9BY43
DIPiDIP-39082N
IntActiQ9BY43, 25 interactors
MINTiQ9BY43
STRINGi9606.ENSP00000324205

PTM databases

iPTMnetiQ9BY43
PhosphoSitePlusiQ9BY43

Polymorphism and mutation databases

BioMutaiCHMP4A
DMDMi90152096

Proteomic databases

EPDiQ9BY43
jPOSTiQ9BY43
MassIVEiQ9BY43
MaxQBiQ9BY43
PaxDbiQ9BY43
PeptideAtlasiQ9BY43
PRIDEiQ9BY43
ProteomicsDBi60344
79580 [Q9BY43-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		56042, 37 antibodies

The DNASU plasmid repository

More...DNASUi		29082

Genome annotation databases

EnsembliENST00000347519; ENSP00000324205; ENSG00000254505 [Q9BY43-1]
ENST00000645308; ENSP00000495982; ENSG00000285302 [Q9BY43-1]
GeneIDi29082
KEGGihsa:29082
UCSCiuc001wni.4, human [Q9BY43-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		29082
DisGeNETi29082
EuPathDBiHostDB:ENSG00000254505.9

GeneCards: human genes, protein and diseases

More...GeneCardsi		CHMP4A
HGNCiHGNC:20274, CHMP4A
HPAiENSG00000254505, Low tissue specificity
MIMi610051, gene
neXtProtiNX_Q9BY43
OpenTargetsiENSG00000254505
PharmGKBiPA134888743

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1656, Eukaryota
GeneTreeiENSGT00940000163323
HOGENOMiCLU_071097_0_1_1
InParanoidiQ9BY43
KOiK12194
OMAiKQEFLEH
OrthoDBi1490465at2759
PhylomeDBiQ9BY43
TreeFamiTF314269

Enzyme and pathway databases

PathwayCommonsiQ9BY43
ReactomeiR-HSA-162588, Budding and maturation of HIV virion
R-HSA-1632852, Macroautophagy
R-HSA-917729, Endosomal Sorting Complex Required For Transport (ESCRT)
R-HSA-9610379, HCMV Late Events
R-HSA-9615710, Late endosomal microautophagy
R-HSA-9668328, Sealing of the nuclear envelope (NE) by ESCRT-III
SignaLinkiQ9BY43

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		29082, 7 hits in 870 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CHMP4A, human
EvolutionaryTraceiQ9BY43

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		CHMP4A

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		29082
PharosiQ9BY43, Tbio

Protein Ontology

More...PROi		PR:Q9BY43
RNActiQ9BY43, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000254505, Expressed in frontal cortex and 116 other tissues
ExpressionAtlasiQ9BY43, baseline and differential
GenevisibleiQ9BY43, HS

Family and domain databases

InterProiView protein in InterPro
IPR005024, Snf7_fam
PfamiView protein in Pfam
PF03357, Snf7, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCHM4A_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BY43
Secondary accession number(s): Q14D22
, Q32Q79, Q86SZ8, Q96QJ9, Q9P026
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 2002
Last sequence update: February 7, 2006
Last modified: August 12, 2020
This is version 172 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again