Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 135 (13 Feb 2019)
Sequence version 2 (08 Apr 2008)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Electrogenic sodium bicarbonate cotransporter 4

Gene

SLC4A5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Mediates sodium- and bicarbonate-dependent electrogenic sodium bicarbonate cotransport, with a Na+:HCO3- stoichiometry of 2:1. May have a housekeeping function in regulating the pH of tissues in which it is expressed. May play a role in mediating Na+:HCO3- cotransport in hepatocytes and intrahepatic cholangiocytes. Also may be important in protecting the renal paranchyma from alterations in urine pH.By similarity3 Publications

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Activity is inhibited by 4,4'-di-isothiocyanatostilbene-2,2'-disulfonic acid (DIDS - an inhibitor of several anion channels and transporters).

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processAnion exchange, Ion transport, Sodium transport, Transport
LigandSodium

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-425381 Bicarbonate transporters

Protein family/group databases

Transport Classification Database

More...
TCDBi
2.A.31.2.8 the anion exchanger (ae) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Electrogenic sodium bicarbonate cotransporter 4
Alternative name(s):
NBCe2
Solute carrier family 4 member 5
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLC4A5Imported
Synonyms:NBC4Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000188687.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:18168 SLC4A5

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606757 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BY07

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 521CytoplasmicSequence analysisAdd BLAST521
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei522 – 544HelicalSequence analysisAdd BLAST23
Topological domaini545 – 555ExtracellularSequence analysisAdd BLAST11
Transmembranei556 – 587HelicalSequence analysisAdd BLAST32
Topological domaini588 – 606CytoplasmicSequence analysisAdd BLAST19
Transmembranei607 – 628HelicalSequence analysisAdd BLAST22
Topological domaini629 – 742ExtracellularSequence analysisAdd BLAST114
Transmembranei743 – 762HelicalSequence analysisAdd BLAST20
Topological domaini763 – 773CytoplasmicSequence analysisAdd BLAST11
Transmembranei774 – 795HelicalSequence analysisAdd BLAST22
Topological domaini796 – 828ExtracellularSequence analysisAdd BLAST33
Transmembranei829 – 847HelicalSequence analysisAdd BLAST19
Topological domaini848 – 866CytoplasmicSequence analysisAdd BLAST19
Transmembranei867 – 883HelicalSequence analysisAdd BLAST17
Topological domaini884 – 888ExtracellularSequence analysis5
Transmembranei889 – 908HelicalSequence analysisAdd BLAST20
Topological domaini909 – 928CytoplasmicSequence analysisAdd BLAST20
Transmembranei929 – 948HelicalSequence analysisAdd BLAST20
Topological domaini949 – 953ExtracellularSequence analysis5
Transmembranei954 – 971HelicalSequence analysisAdd BLAST18
Topological domaini972 – 1016CytoplasmicSequence analysisAdd BLAST45
Transmembranei1017 – 1034HelicalSequence analysisAdd BLAST18
Topological domaini1035 – 1039ExtracellularSequence analysis5
Transmembranei1040 – 1057HelicalSequence analysisAdd BLAST18
Topological domaini1058 – 1137CytoplasmicSequence analysisAdd BLAST80

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
57835

Open Targets

More...
OpenTargetsi
ENSG00000188687

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164742397

Chemistry databases

Drug and drug target database

More...
DrugBanki
DB01390 Sodium bicarbonate

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SLC4A5

Domain mapping of disease mutations (DMDM)

More...
DMDMi
182691595

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003289201 – 1137Electrogenic sodium bicarbonate cotransporter 4Add BLAST1137

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi679 ↔ 681By similarity
Disulfide bondi725 ↔ 737By similarity

Keywords - PTMi

Disulfide bond

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9BY07

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9BY07

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BY07

PeptideAtlas

More...
PeptideAtlasi
Q9BY07

PRoteomics IDEntifications database

More...
PRIDEi
Q9BY07

ProteomicsDB human proteome resource

More...
ProteomicsDBi
79546
79547 [Q9BY07-2]
79548 [Q9BY07-3]
79549 [Q9BY07-4]
79550 [Q9BY07-5]
79551 [Q9BY07-6]
79552 [Q9BY07-7]
79553 [Q9BY07-8]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BY07

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BY07

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highest expression observed in liver, spleen and testis; moderate expression in the choroid plexus, hippocampus, cerebrum and cerebellum of brain, and in kidney cortex and kidney medulla. Also observed in heart, pancreas, muscle, lung, placenta, stomach and small intestine. Weakest expression seen in peripheral blood lymphocytes, colon, duodenum, jejunum, ileum and skeletal muscle.4 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000188687 Expressed in 91 organ(s), highest expression level in thyroid gland

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9BY07 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BY07 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA036621

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121791, 1 interactor

Protein interaction database and analysis system

More...
IntActi
Q9BY07, 1 interactor

Molecular INTeraction database

More...
MINTi
Q9BY07

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000350475

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9BY07

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9BY07

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi433 – 497Gly-richSequence analysisAdd BLAST65

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the anion exchanger (TC 2.A.31) family. [View classification]Sequence analysis

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1172 Eukaryota
ENOG410XPHD LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157488

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG004326

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BY07

KEGG Orthology (KO)

More...
KOi
K13857

Identification of Orthologs from Complete Genome Data

More...
OMAi
KNPWWIY

Database of Orthologous Groups

More...
OrthoDBi
265068at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BY07

TreeFam database of animal gene trees

More...
TreeFami
TF313630

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.930.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013769 Band3_cytoplasmic_dom
IPR011531 HCO3_transpt_C
IPR003020 HCO3_transpt_euk
IPR003024 Na/HCO3_transpt
IPR016152 PTrfase/Anion_transptr

The PANTHER Classification System

More...
PANTHERi
PTHR11453 PTHR11453, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07565 Band_3_cyto, 1 hit
PF00955 HCO3_cotransp, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01231 HCO3TRNSPORT
PR01232 NAHCO3TRSPRT

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF55804 SSF55804, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00834 ae, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: Q9BY07-1) [UniParc]FASTAAdd to basket
Also known as: NBC4a1 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKVKEEKAGV GKLDHTNHRR RFPDQKECPP IHIGLPVPTY PQRKTDQKGH
60 70 80 90 100
LSGLQKVHWG LRPDQPQQEL TGPGSGASSQ DSSMDLISRT RSPAAEQLQD
110 120 130 140 150
ILGEEDEAPN PTLFTEMDTL QHDGDQMEWK ESARWIKFEE KVEEGGERWS
160 170 180 190 200
KPHVSTLSLH SLFELRTCLQ TGTVLLDLDS GSLPQIIDDV IEKQIEDGLL
210 220 230 240 250
RPELRERVSY VLLRRHRHQT KKPIHRSLAD IGKSVSTTNR SPARSPGAGP
260 270 280 290 300
SLHHSTEDLR MRQSANYGRL CHAQSRSMND ISLTPNTDQR KNKFMKKIPK
310 320 330 340 350
DSEASNVLVG EVDFLDQPFI AFVRLIQSAM LGGVTEVPVP TRFLFILLGP
360 370 380 390 400
SGRAKSYNEI GRAIATLMVD DLFSDVAYKA RNREDLIAGI DEFLDEVIVL
410 420 430 440 450
PPGEWDPNIR IEPPKKVPSA DKRKSVFSLA ELGQMNGSVG GGGGAPGGGN
460 470 480 490 500
GGGGGGGSGG GAGSGGAGGT SSGDDGEMPA MHEIGEELIW TGRFFGGLCL
510 520 530 540 550
DIKRKLPWFP SDFYDGFHIQ SISAILFIYL GCITNAITFG GLLGDATDNY
560 570 580 590 600
QGVMESFLGT AMAGSLFCLF SGQPLIILSS TGPILIFEKL LFDFSKGNGL
610 620 630 640 650
DYMEFRLWIG LHSAVQCLIL VATDASFIIK YITRFTEEGF STLISFIFIY
660 670 680 690 700
DAIKKMIGAF KYYPINMDFK PNFITTYKCE CVAPDTVNTT VFNASAPLAP
710 720 730 740 750
DTNASLYNLL NLTALDWSLL SKKECLSYGG RLLGNSCKFI PDLALMSFIL
760 770 780 790 800
FFGTYSMTLT LKKFKFSRYF PTKVRALVAD FSIVFSILMF CGIDACFGLE
810 820 830 840 850
TPKLHVPSVI KPTRPDRGWF VAPFGKNPWW VYPASILPAL LVTILIFMDQ
860 870 880 890 900
QITAVIVNRK ENKLKKAAGY HLDLFWVGIL MALCSFMGLP WYVAATVISI
910 920 930 940 950
AHIDSLKMET ETSAPGEQPQ FLGVREQRVT GIIVFILTGI SVFLAPILKC
960 970 980 990 1000
IPLPVLYGVF LYMGVASLNG IQMGTGGSEF KIQKKLTPFW ERCKLFLMPA
1010 1020 1030 1040 1050
KHQPDHAFLR HVPLRRIHLF TLVQILCLAV LWILKSTVAA IIFPVMILGL
1060 1070 1080 1090 1100
IIVRRLLDFI FSQHDLAWID NILPEKEKKE TDKKRKRKKG AHEDCDEEPQ
1110 1120 1130
FPPPSVIKIP MESVQSDPQN GIHCIARKRS SSWSYSL
Length:1,137
Mass (Da):126,255
Last modified:April 8, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iED4E4A4DC2CA17F1
GO
Isoform 22 Publications (identifier: Q9BY07-2) [UniParc]FASTAAdd to basket
Also known as: NBC4b1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1046-1046: M → MSLSTTD

Show »
Length:1,143
Mass (Da):126,860
Checksum:i3C32B411955873FD
GO
Isoform 31 Publication (identifier: Q9BY07-3) [UniParc]FASTAAdd to basket
Also known as: NBC4c1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     973-988: Missing.

Show »
Length:1,121
Mass (Da):124,551
Checksum:iDC17DB7C69ABD27D
GO
Isoform 41 Publication (identifier: Q9BY07-4) [UniParc]FASTAAdd to basket
Also known as: NBC4d1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     950-1046: Missing.

Show »
Length:1,040
Mass (Da):115,240
Checksum:iFEE31CEF13F4F57B
GO
Isoform 5 (identifier: Q9BY07-5) [UniParc]FASTAAdd to basket
Also known as: isoform d variant

The sequence of this isoform differs from the canonical sequence as follows:
     88-91: SRTR → EHKG
     866-993: KAAGYHLDLF...KKLTPFWERC → GTESNRHHRL...HLFPARPGLD
     994-1137: Missing.

Note: No experimental confirmation available. Incomplete sequence.Curated
Show »
Length:993
Mass (Da):108,663
Checksum:i9C45DA4AC127035F
GO
Isoform 61 Publication (identifier: Q9BY07-6) [UniParc]FASTAAdd to basket
Also known as: NBC4f1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     774-811: Missing.
     866-924: Missing.
     973-988: Missing.
     1046-1046: M → MSLSTTD
     1071-1075: NILPE → KIEFP
     1076-1137: Missing.

Show »
Length:968
Mass (Da):107,526
Checksum:i61243CD7DF614154
GO
Isoform 71 Publication (identifier: Q9BY07-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     27-91: ECPPIHIGLPVPTYPQRKTDQKGHLSGLQKVHWGLRPDQPQQELTGPGSGASSQDSSMDLISRTR → G
     774-811: Missing.
     973-988: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:1,019
Mass (Da):113,390
Checksum:i93AAC3C3E0649931
GO
Isoform 81 Publication (identifier: Q9BY07-8) [UniParc]FASTAAdd to basket
Also known as: NBC4e1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1068-1137: Missing.

Show »
Length:1,067
Mass (Da):118,125
Checksum:i7D1BA0C19F65AC3F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7EQT3E7EQT3_HUMAN
Anion exchange protein
SLC4A5 hCG_1988260
998Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GUV9A0A1B0GUV9_HUMAN
Electrogenic sodium bicarbonate cot...
SLC4A5
71Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GVY3A0A1B0GVY3_HUMAN
Electrogenic sodium bicarbonate cot...
SLC4A5
210Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JNL6C9JNL6_HUMAN
Electrogenic sodium bicarbonate cot...
SLC4A5
122Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JU12C9JU12_HUMAN
Electrogenic sodium bicarbonate cot...
SLC4A5
144Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JW32C9JW32_HUMAN
Electrogenic sodium bicarbonate cot...
SLC4A5
129Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAG18492 differs from that shown. Reason: Frameshift at position 1047.Curated
The sequence AAL50802 differs from that shown. Reason: Frameshift at positions 760, 925 and 1047.Curated
The sequence EAW99691 differs from that shown. Reason: Frameshift at position 1047.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti612H → Y in AAL48291 (PubMed:12388414).Curated1
Sequence conflicti612H → Y in AAL50802 (PubMed:12388414).Curated1
Sequence conflicti699A → T in AAL48291 (PubMed:12388414).Curated1
Sequence conflicti759L → R in AAL50802 (PubMed:12388414).Curated1
Sequence conflicti813T → P in AAK26741 (PubMed:11087115).Curated1
Sequence conflicti896T → M in AAL48291 (PubMed:12388414).Curated1
Sequence conflicti923G → R in AAL48291 (PubMed:12388414).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_048350251S → N. Corresponds to variant dbSNP:rs17009792Ensembl.1
Natural variantiVAR_061032253H → Y1 PublicationCorresponds to variant dbSNP:rs55651232Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_05277027 – 91ECPPI…ISRTR → G in isoform 7. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_05277188 – 91SRTR → EHKG in isoform 5. 1 Publication4
Alternative sequenceiVSP_052772774 – 811Missing in isoform 6 and isoform 7. 2 PublicationsAdd BLAST38
Alternative sequenceiVSP_052773866 – 993KAAGY…FWERC → GTESNRHHRLHPDGNLCLPG SHPKVYPPAGAVRSLPLHGR GLPEWHPVLGTLQALPDASQ APAGPCLPAARAAAPDPPLH PGADPLPGGALDPQIHGGCH HLPGHDPGPHHRSKASGFHL FPARPGLD in isoform 5. 1 PublicationAdd BLAST128
Alternative sequenceiVSP_052774866 – 924Missing in isoform 6. 1 PublicationAdd BLAST59
Alternative sequenceiVSP_052775950 – 1046Missing in isoform 4. 1 PublicationAdd BLAST97
Alternative sequenceiVSP_052776973 – 988Missing in isoform 3, isoform 6 and isoform 7. 4 PublicationsAdd BLAST16
Alternative sequenceiVSP_052777994 – 1137Missing in isoform 5. 1 PublicationAdd BLAST144
Alternative sequenceiVSP_0527781046M → MSLSTTD in isoform 2 and isoform 6. 3 Publications1
Alternative sequenceiVSP_0527791068 – 1137Missing in isoform 8. 1 PublicationAdd BLAST70
Alternative sequenceiVSP_0527801071 – 1075NILPE → KIEFP in isoform 6. 1 Publication5
Alternative sequenceiVSP_0527811076 – 1137Missing in isoform 6. 1 PublicationAdd BLAST62

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF207661 mRNA Translation: AAG18492.1 Frameshift.
AF243499 mRNA Translation: AAK26741.1
AF293338 mRNA Translation: AAK97073.1
AF293337 mRNA Translation: AAK97072.1
AF452248 mRNA Translation: AAL48291.1
AF453528 mRNA Translation: AAL50802.1 Frameshift.
CH471053 Genomic DNA Translation: EAW99690.1
CH471053 Genomic DNA Translation: EAW99691.1 Frameshift.
CH471053 Genomic DNA Translation: EAW99693.1
BC109221 mRNA Translation: AAI09222.1
AB209752 mRNA Translation: BAD92989.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1936.1 [Q9BY07-1]
CCDS1937.1 [Q9BY07-3]

NCBI Reference Sequences

More...
RefSeqi
NP_067019.3, NM_021196.3 [Q9BY07-1]
NP_597812.1, NM_133478.2 [Q9BY07-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.594099

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000346834; ENSP00000251768; ENSG00000188687 [Q9BY07-1]
ENST00000358683; ENSP00000351513; ENSG00000188687 [Q9BY07-7]
ENST00000377632; ENSP00000366859; ENSG00000188687 [Q9BY07-4]
ENST00000377634; ENSP00000366861; ENSG00000188687 [Q9BY07-1]
ENST00000394019; ENSP00000377587; ENSG00000188687 [Q9BY07-3]
ENST00000423644; ENSP00000395804; ENSG00000188687 [Q9BY07-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57835

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57835

UCSC genome browser

More...
UCSCi
uc002skn.3 human [Q9BY07-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF207661 mRNA Translation: AAG18492.1 Frameshift.
AF243499 mRNA Translation: AAK26741.1
AF293338 mRNA Translation: AAK97073.1
AF293337 mRNA Translation: AAK97072.1
AF452248 mRNA Translation: AAL48291.1
AF453528 mRNA Translation: AAL50802.1 Frameshift.
CH471053 Genomic DNA Translation: EAW99690.1
CH471053 Genomic DNA Translation: EAW99691.1 Frameshift.
CH471053 Genomic DNA Translation: EAW99693.1
BC109221 mRNA Translation: AAI09222.1
AB209752 mRNA Translation: BAD92989.1
CCDSiCCDS1936.1 [Q9BY07-1]
CCDS1937.1 [Q9BY07-3]
RefSeqiNP_067019.3, NM_021196.3 [Q9BY07-1]
NP_597812.1, NM_133478.2 [Q9BY07-3]
UniGeneiHs.594099

3D structure databases

ProteinModelPortaliQ9BY07
SMRiQ9BY07
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121791, 1 interactor
IntActiQ9BY07, 1 interactor
MINTiQ9BY07
STRINGi9606.ENSP00000350475

Chemistry databases

DrugBankiDB01390 Sodium bicarbonate

Protein family/group databases

TCDBi2.A.31.2.8 the anion exchanger (ae) family

PTM databases

iPTMnetiQ9BY07
PhosphoSitePlusiQ9BY07

Polymorphism and mutation databases

BioMutaiSLC4A5
DMDMi182691595

Proteomic databases

jPOSTiQ9BY07
MaxQBiQ9BY07
PaxDbiQ9BY07
PeptideAtlasiQ9BY07
PRIDEiQ9BY07
ProteomicsDBi79546
79547 [Q9BY07-2]
79548 [Q9BY07-3]
79549 [Q9BY07-4]
79550 [Q9BY07-5]
79551 [Q9BY07-6]
79552 [Q9BY07-7]
79553 [Q9BY07-8]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000346834; ENSP00000251768; ENSG00000188687 [Q9BY07-1]
ENST00000358683; ENSP00000351513; ENSG00000188687 [Q9BY07-7]
ENST00000377632; ENSP00000366859; ENSG00000188687 [Q9BY07-4]
ENST00000377634; ENSP00000366861; ENSG00000188687 [Q9BY07-1]
ENST00000394019; ENSP00000377587; ENSG00000188687 [Q9BY07-3]
ENST00000423644; ENSP00000395804; ENSG00000188687 [Q9BY07-3]
GeneIDi57835
KEGGihsa:57835
UCSCiuc002skn.3 human [Q9BY07-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57835
DisGeNETi57835
EuPathDBiHostDB:ENSG00000188687.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SLC4A5
HGNCiHGNC:18168 SLC4A5
HPAiHPA036621
MIMi606757 gene
neXtProtiNX_Q9BY07
OpenTargetsiENSG00000188687
PharmGKBiPA164742397

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1172 Eukaryota
ENOG410XPHD LUCA
GeneTreeiENSGT00940000157488
HOVERGENiHBG004326
InParanoidiQ9BY07
KOiK13857
OMAiKNPWWIY
OrthoDBi265068at2759
PhylomeDBiQ9BY07
TreeFamiTF313630

Enzyme and pathway databases

ReactomeiR-HSA-425381 Bicarbonate transporters

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SLC4A5 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SLC4A5

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57835

Protein Ontology

More...
PROi
PR:Q9BY07

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000188687 Expressed in 91 organ(s), highest expression level in thyroid gland
ExpressionAtlasiQ9BY07 baseline and differential
GenevisibleiQ9BY07 HS

Family and domain databases

Gene3Di3.40.930.10, 1 hit
InterProiView protein in InterPro
IPR013769 Band3_cytoplasmic_dom
IPR011531 HCO3_transpt_C
IPR003020 HCO3_transpt_euk
IPR003024 Na/HCO3_transpt
IPR016152 PTrfase/Anion_transptr
PANTHERiPTHR11453 PTHR11453, 1 hit
PfamiView protein in Pfam
PF07565 Band_3_cyto, 1 hit
PF00955 HCO3_cotransp, 1 hit
PRINTSiPR01231 HCO3TRNSPORT
PR01232 NAHCO3TRSPRT
SUPFAMiSSF55804 SSF55804, 1 hit
TIGRFAMsiTIGR00834 ae, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiS4A5_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BY07
Secondary accession number(s): Q32MA7
, Q59EQ9, Q8WXD3, Q8WXD7, Q96DS7, Q96DS8, Q9HBU5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: April 8, 2008
Last modified: February 13, 2019
This is version 135 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again