Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein BEX2

Gene

BEX2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulator of mitochondrial apoptosis and G1 cell cycle in breast cancer. Protects the breast cancer cells against mitochondrial apoptosis and this effect is mediated through the modulation of BCL2 protein family, which involves the positive regulation of anti-apoptotic member BCL2 and the negative regulation of pro-apoptotic members BAD, BAK1 and PUMA. Required for the normal cell cycle progression during G1 in breast cancer cells through the regulation of CCND1 and CDKN1A. Regulates the level of PP2A regulatory subunit B and PP2A phosphatase activity.1 Publication

Caution

Was named BEX1 by some authors.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

  • apoptotic process Source: UniProtKB-KW
  • cell cycle Source: UniProtKB-KW
  • regulation of apoptotic process Source: UniProtKB
  • regulation of cell cycle Source: UniProtKB

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis, Cell cycle

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein BEX2
Alternative name(s):
Brain-expressed X-linked protein 2
Short name:
hBex2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BEX2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000133134.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30933 BEX2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
300691 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BXY8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
84707

Open Targets

More...
OpenTargetsi
ENSG00000133134

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134977614

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
BEX2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74752443

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002297771 – 128Protein BEX2Add BLAST128

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei50Omega-N-methylarginineBy similarity1

Keywords - PTMi

Methylation

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BXY8

PeptideAtlas

More...
PeptideAtlasi
Q9BXY8

PRoteomics IDEntifications database

More...
PRIDEi
Q9BXY8

ProteomicsDB human proteome resource

More...
ProteomicsDBi
79545

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BXY8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BXY8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in central nervous system, with high level in pituitary, cerebellum and temporal lobe. Widely expressed in breast cancer cell lines.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000133134 Expressed in 196 organ(s), highest expression level in pituitary gland

CleanEx database of gene expression profiles

More...
CleanExi
HS_BEX2

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9BXY8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BXY8 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA045384

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with OMP (By similarity). Interacts with LMO2, possibly leading to regulate the transcriptional activity of a DNA-binding complex containing LMO2.By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
124218, 34 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9BXY8

Protein interaction database and analysis system

More...
IntActi
Q9BXY8, 79 interactors

Molecular INTeraction database

More...
MINTi
Q9BXY8

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000442521

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9BXY8

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the BEX family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410JBJY Eukaryota
ENOG4111DNW LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153412

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000236300

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG080240

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BXY8

Identification of Orthologs from Complete Genome Data

More...
OMAi
PHVENRE

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0ZN3

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BXY8

TreeFam database of animal gene trees

More...
TreeFami
TF337909

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007623 BEX
IPR021156 TF_A-like/BEX

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04538 BEX, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF008633 BEX, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BXY8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MESKEERALN NLIVENVNQE NDEKDEKEQV ANKGEPLALP LNVSEYCVPR
60 70 80 90 100
GNRRRFRVRQ PILQYRWDIM HRLGEPQARM REENMERIGE EVRQLMEKLR
110 120
EKQLSHSLRA VSTDPPHHDH HDEFCLMP
Length:128
Mass (Da):15,321
Last modified:June 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF6302EC28F71D2A8
GO
Isoform 2 (identifier: Q9BXY8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQKMVVCGAKCCGDAPHVENREEETARIGPGVM

Note: Gene prediction based on EST data.
Show »
Length:160
Mass (Da):18,719
Checksum:i0C3D806EE0A4A527
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
X6RDN0X6RDN0_HUMAN
Protein BEX2
BEX2
101Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0468081M → MQKMVVCGAKCCGDAPHVEN REEETARIGPGVM in isoform 2. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY833560 mRNA Translation: AAX40678.1
AF251053 mRNA Translation: AAK34943.1
AK312085 mRNA Translation: BAG35021.1
AL133348 Genomic DNA No translation available.
Z70233 Genomic DNA Translation: CAD24039.1
CH471190 Genomic DNA Translation: EAW54715.1
CH471190 Genomic DNA Translation: EAW54716.1
BC015522 mRNA Translation: AAH15522.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14505.1 [Q9BXY8-1]
CCDS55467.1 [Q9BXY8-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001161871.1, NM_001168399.1 [Q9BXY8-2]
NP_001161872.1, NM_001168400.1
NP_001161873.1, NM_001168401.1 [Q9BXY8-1]
NP_116010.1, NM_032621.3 [Q9BXY8-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.398989

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000372674; ENSP00000361759; ENSG00000133134 [Q9BXY8-1]
ENST00000372677; ENSP00000361762; ENSG00000133134 [Q9BXY8-1]
ENST00000536889; ENSP00000442521; ENSG00000133134 [Q9BXY8-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84707

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84707

UCSC genome browser

More...
UCSCi
uc004eka.4 human [Q9BXY8-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY833560 mRNA Translation: AAX40678.1
AF251053 mRNA Translation: AAK34943.1
AK312085 mRNA Translation: BAG35021.1
AL133348 Genomic DNA No translation available.
Z70233 Genomic DNA Translation: CAD24039.1
CH471190 Genomic DNA Translation: EAW54715.1
CH471190 Genomic DNA Translation: EAW54716.1
BC015522 mRNA Translation: AAH15522.1
CCDSiCCDS14505.1 [Q9BXY8-1]
CCDS55467.1 [Q9BXY8-2]
RefSeqiNP_001161871.1, NM_001168399.1 [Q9BXY8-2]
NP_001161872.1, NM_001168400.1
NP_001161873.1, NM_001168401.1 [Q9BXY8-1]
NP_116010.1, NM_032621.3 [Q9BXY8-1]
UniGeneiHs.398989

3D structure databases

ProteinModelPortaliQ9BXY8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124218, 34 interactors
CORUMiQ9BXY8
IntActiQ9BXY8, 79 interactors
MINTiQ9BXY8
STRINGi9606.ENSP00000442521

PTM databases

iPTMnetiQ9BXY8
PhosphoSitePlusiQ9BXY8

Polymorphism and mutation databases

BioMutaiBEX2
DMDMi74752443

Proteomic databases

PaxDbiQ9BXY8
PeptideAtlasiQ9BXY8
PRIDEiQ9BXY8
ProteomicsDBi79545

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
84707
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372674; ENSP00000361759; ENSG00000133134 [Q9BXY8-1]
ENST00000372677; ENSP00000361762; ENSG00000133134 [Q9BXY8-1]
ENST00000536889; ENSP00000442521; ENSG00000133134 [Q9BXY8-2]
GeneIDi84707
KEGGihsa:84707
UCSCiuc004eka.4 human [Q9BXY8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84707
DisGeNETi84707
EuPathDBiHostDB:ENSG00000133134.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
BEX2
HGNCiHGNC:30933 BEX2
HPAiHPA045384
MIMi300691 gene
neXtProtiNX_Q9BXY8
OpenTargetsiENSG00000133134
PharmGKBiPA134977614

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410JBJY Eukaryota
ENOG4111DNW LUCA
GeneTreeiENSGT00940000153412
HOGENOMiHOG000236300
HOVERGENiHBG080240
InParanoidiQ9BXY8
OMAiPHVENRE
OrthoDBiEOG091G0ZN3
PhylomeDBiQ9BXY8
TreeFamiTF337909

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
BEX2 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
BEX2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84707

Protein Ontology

More...
PROi
PR:Q9BXY8

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000133134 Expressed in 196 organ(s), highest expression level in pituitary gland
CleanExiHS_BEX2
ExpressionAtlasiQ9BXY8 baseline and differential
GenevisibleiQ9BXY8 HS

Family and domain databases

InterProiView protein in InterPro
IPR007623 BEX
IPR021156 TF_A-like/BEX
PfamiView protein in Pfam
PF04538 BEX, 1 hit
PIRSFiPIRSF008633 BEX, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBEX2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BXY8
Secondary accession number(s): B2R574
, D3DXA2, F5H7H5, Q5JVV9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 4, 2006
Last sequence update: June 1, 2001
Last modified: December 5, 2018
This is version 128 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again