Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein BEX2

Gene

BEX2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Regulator of mitochondrial apoptosis and G1 cell cycle in breast cancer. Protects the breast cancer cells against mitochondrial apoptosis and this effect is mediated through the modulation of BCL2 protein family, which involves the positive regulation of anti-apoptotic member BCL2 and the negative regulation of pro-apoptotic members BAD, BAK1 and PUMA. Required for the normal cell cycle progression during G1 in breast cancer cells through the regulation of CCND1 and CDKN1A. Regulates the level of PP2A regulatory subunit B and PP2A phosphatase activity.1 Publication

Caution

Was named BEX1 by some authors.Curated

GO - Biological processi

  • apoptotic process Source: UniProtKB-KW
  • cell cycle Source: UniProtKB-KW
  • regulation of apoptotic process Source: UniProtKB
  • regulation of cell cycle Source: UniProtKB

Keywordsi

Biological processApoptosis, Cell cycle

Names & Taxonomyi

Protein namesi
Recommended name:
Protein BEX2
Alternative name(s):
Brain-expressed X-linked protein 2
Short name:
hBex2
Gene namesi
Name:BEX2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000133134.11
HGNCiHGNC:30933 BEX2
MIMi300691 gene
neXtProtiNX_Q9BXY8

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi84707
OpenTargetsiENSG00000133134
PharmGKBiPA134977614

Polymorphism and mutation databases

BioMutaiBEX2
DMDMi74752443

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002297771 – 128Protein BEX2Add BLAST128

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei50Omega-N-methylarginineBy similarity1

Keywords - PTMi

Methylation

Proteomic databases

PaxDbiQ9BXY8
PeptideAtlasiQ9BXY8
PRIDEiQ9BXY8
ProteomicsDBi79545

PTM databases

iPTMnetiQ9BXY8
PhosphoSitePlusiQ9BXY8

Expressioni

Tissue specificityi

Expressed in central nervous system, with high level in pituitary, cerebellum and temporal lobe. Widely expressed in breast cancer cell lines.2 Publications

Gene expression databases

BgeeiENSG00000133134
CleanExiHS_BEX2
ExpressionAtlasiQ9BXY8 baseline and differential
GenevisibleiQ9BXY8 HS

Organism-specific databases

HPAiHPA045384

Interactioni

Subunit structurei

Interacts with OMP (By similarity). Interacts with LMO2, possibly leading to regulate the transcriptional activity of a DNA-binding complex containing LMO2.By similarity1 Publication

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi124218, 34 interactors
CORUMiQ9BXY8
IntActiQ9BXY8, 79 interactors
MINTiQ9BXY8
STRINGi9606.ENSP00000442521

Structurei

3D structure databases

ProteinModelPortaliQ9BXY8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the BEX family.Curated

Phylogenomic databases

eggNOGiENOG410JBJY Eukaryota
ENOG4111DNW LUCA
GeneTreeiENSGT00810000125540
HOGENOMiHOG000236300
HOVERGENiHBG080240
InParanoidiQ9BXY8
OMAiRWDIMHR
OrthoDBiEOG091G0ZN3
PhylomeDBiQ9BXY8
TreeFamiTF337909

Family and domain databases

InterProiView protein in InterPro
IPR007623 BEX
IPR021156 TF_A-like/BEX
PfamiView protein in Pfam
PF04538 BEX, 1 hit
PIRSFiPIRSF008633 BEX, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BXY8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MESKEERALN NLIVENVNQE NDEKDEKEQV ANKGEPLALP LNVSEYCVPR
60 70 80 90 100
GNRRRFRVRQ PILQYRWDIM HRLGEPQARM REENMERIGE EVRQLMEKLR
110 120
EKQLSHSLRA VSTDPPHHDH HDEFCLMP
Length:128
Mass (Da):15,321
Last modified:June 1, 2001 - v1
Checksum:iF6302EC28F71D2A8
GO
Isoform 2 (identifier: Q9BXY8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQKMVVCGAKCCGDAPHVENREEETARIGPGVM

Note: Gene prediction based on EST data.
Show »
Length:160
Mass (Da):18,719
Checksum:i0C3D806EE0A4A527
GO

Sequence cautioni

The sequence CAI43072 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0468081M → MQKMVVCGAKCCGDAPHVEN REEETARIGPGVM in isoform 2. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY833560 mRNA Translation: AAX40678.1
AF251053 mRNA Translation: AAK34943.1
AK312085 mRNA Translation: BAG35021.1
AL133348 Genomic DNA Translation: CAI43071.1
AL133348 Genomic DNA Translation: CAI43072.1 Sequence problems.
Z70233 Genomic DNA Translation: CAD24039.1
CH471190 Genomic DNA Translation: EAW54715.1
CH471190 Genomic DNA Translation: EAW54716.1
BC015522 mRNA Translation: AAH15522.1
CCDSiCCDS14505.1 [Q9BXY8-1]
CCDS55467.1 [Q9BXY8-2]
RefSeqiNP_001161871.1, NM_001168399.1 [Q9BXY8-2]
NP_001161872.1, NM_001168400.1
NP_001161873.1, NM_001168401.1 [Q9BXY8-1]
NP_116010.1, NM_032621.3 [Q9BXY8-1]
UniGeneiHs.398989

Genome annotation databases

EnsembliENST00000372674; ENSP00000361759; ENSG00000133134 [Q9BXY8-1]
ENST00000372677; ENSP00000361762; ENSG00000133134 [Q9BXY8-1]
ENST00000536889; ENSP00000442521; ENSG00000133134 [Q9BXY8-2]
GeneIDi84707
KEGGihsa:84707
UCSCiuc004eka.4 human [Q9BXY8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiBEX2_HUMAN
AccessioniPrimary (citable) accession number: Q9BXY8
Secondary accession number(s): B2R574
, D3DXA2, F5H7H5, Q5JVV9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 4, 2006
Last sequence update: June 1, 2001
Last modified: July 18, 2018
This is version 125 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health