Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Calcium-binding protein 8

Gene

CALN1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Negatively regulates Golgi-to-plasma membrane trafficking by interacting with PI4KB and inhibiting its activity (By similarity). May play a role in the physiology of neurons and is potentially important in memory and learning.By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Calcium bindingi49 – 601PROSITE-ProRule annotationAdd BLAST12
Calcium bindingi85 – 962PROSITE-ProRule annotationAdd BLAST12

GO - Molecular functioni

Keywordsi

LigandCalcium, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Calcium-binding protein 8
Short name:
CaBP8
Alternative name(s):
Calneuron I
Calneuron-1
Gene namesi
Name:CALN1
Synonyms:CABP8
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000183166.10
HGNCiHGNC:13248 CALN1
MIMi607176 gene
neXtProtiNX_Q9BXU9

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 192CytoplasmicSequence analysisAdd BLAST192
Transmembranei193 – 213Helical; Anchor for type IV membrane proteinSequence analysisAdd BLAST21
Topological domaini214 – 219ExtracellularSequence analysis6

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi83698
OpenTargetsiENSG00000183166
PharmGKBiPA26045

Polymorphism and mutation databases

BioMutaiCALN1
DMDMi20177867

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000735291 – 219Calcium-binding protein 8Add BLAST219

Proteomic databases

PaxDbiQ9BXU9
PRIDEiQ9BXU9
ProteomicsDBi79523

PTM databases

PhosphoSitePlusiQ9BXU9

Expressioni

Tissue specificityi

Brain specific.

Gene expression databases

BgeeiENSG00000183166 Expressed in 97 organ(s), highest expression level in cerebellum
CleanExiHS_CALN1
ExpressionAtlasiQ9BXU9 baseline and differential
GenevisibleiQ9BXU9 HS

Organism-specific databases

HPAiHPA036278
HPA036708

Interactioni

Subunit structurei

Interacts with PI4KB. This binding competes with FREQ/NCS1 binding in a calcium-dependent manner (By similarity).By similarity

Protein-protein interaction databases

BioGridi123732, 1 interactor
IntActiQ9BXU9, 8 interactors
STRINGi9606.ENSP00000378690

Structurei

3D structure databases

ProteinModelPortaliQ9BXU9
SMRiQ9BXU9
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini36 – 71EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini72 – 107EF-hand 2PROSITE-ProRule annotationAdd BLAST36

Domaini

The C-terminal transmembrane domain (TMD) is necessary and sufficient for membrane targeting.

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0027 Eukaryota
COG5126 LUCA
GeneTreeiENSGT00740000115520
HOGENOMiHOG000252990
InParanoidiQ9BXU9
OMAiREKMPFH
OrthoDBiEOG091G0IMT
PhylomeDBiQ9BXU9
TreeFamiTF331025

Family and domain databases

CDDicd00051 EFh, 1 hit
InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
IPR001751 S100/CaBP-9k_CS
PfamiView protein in Pfam
PF13499 EF-hand_7, 1 hit
SMARTiView protein in SMART
SM00054 EFh, 2 hits
SUPFAMiSSF47473 SSF47473, 1 hit
PROSITEiView protein in PROSITE
PS00018 EF_HAND_1, 2 hits
PS50222 EF_HAND_2, 2 hits

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BXU9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPFHHVTAGL LYKGNYLNRS LSAGSDSEQL ANISVEELDE IREAFRVLDR
60 70 80 90 100
DGNGFISKQE LGMAMRSLGY MPSEVELAII MQRLDMDGDG QVDFDEFMTI
110 120 130 140 150
LGPKLVSSEG RDGFLGNTID SIFWQFDMQR ITLEELKHIL YHAFRDHLTM
160 170 180 190 200
KDIENIIINE EESLNETSGN CQTEFEGVHS QKQNRQTCVR KSLICAFAMA
210
FIISVMLIAA NQILRSGME
Length:219
Mass (Da):24,837
Last modified:June 1, 2001 - v1
Checksum:iEAD2BE2090F5CA0F
GO
Isoform 2 (identifier: Q9BXU9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRLPEQPGEGKPENEKKGDGGALGGGEEPPRSQAPDFPTWEKM

Show »
Length:261
Mass (Da):29,324
Checksum:i8276320AD714FACD
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PFU3E9PFU3_HUMAN
Calcium-binding protein 8
CALN1
125Annotation score:
A0A0A0MSB7A0A0A0MSB7_HUMAN
Calcium-binding protein 8
CALN1
95Annotation score:

Sequence cautioni

The sequence AAG09620 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0471481M → MRLPEQPGEGKPENEKKGDG GALGGGEEPPRSQAPDFPTW EKM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF282250 mRNA Translation: AAK15155.1
AY007302 mRNA Translation: AAG09620.1 Different initiation.
BC020200 mRNA Translation: AAH20200.1
AC004845 Genomic DNA No translation available.
AC004905 Genomic DNA No translation available.
AC005011 Genomic DNA No translation available.
AC006334 Genomic DNA No translation available.
AC067941 Genomic DNA No translation available.
AC092424 Genomic DNA No translation available.
AC092785 Genomic DNA No translation available.
CH471140 Genomic DNA Translation: EAX07902.1
CCDSiCCDS47603.1 [Q9BXU9-2]
CCDS5541.1 [Q9BXU9-1]
RefSeqiNP_001017440.1, NM_001017440.2 [Q9BXU9-1]
NP_113656.2, NM_031468.3 [Q9BXU9-2]
XP_011514897.1, XM_011516595.1
XP_011514898.1, XM_011516596.2 [Q9BXU9-1]
XP_011514899.1, XM_011516597.2 [Q9BXU9-1]
XP_011514901.1, XM_011516599.1 [Q9BXU9-1]
XP_016868164.1, XM_017012675.1 [Q9BXU9-2]
XP_016868165.1, XM_017012676.1 [Q9BXU9-2]
XP_016868167.1, XM_017012678.1 [Q9BXU9-1]
XP_016868168.1, XM_017012679.1 [Q9BXU9-1]
XP_016868169.1, XM_017012680.1 [Q9BXU9-1]
XP_016868170.1, XM_017012681.1 [Q9BXU9-1]
XP_016868171.1, XM_017012682.1 [Q9BXU9-1]
XP_016868172.1, XM_017012683.1 [Q9BXU9-1]
UniGeneiHs.592750

Genome annotation databases

EnsembliENST00000329008; ENSP00000332498; ENSG00000183166 [Q9BXU9-1]
ENST00000395275; ENSP00000378690; ENSG00000183166 [Q9BXU9-2]
ENST00000395276; ENSP00000378691; ENSG00000183166 [Q9BXU9-1]
ENST00000431984; ENSP00000410704; ENSG00000183166 [Q9BXU9-1]
GeneIDi83698
KEGGihsa:83698
UCSCiuc003twa.5 human [Q9BXU9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF282250 mRNA Translation: AAK15155.1
AY007302 mRNA Translation: AAG09620.1 Different initiation.
BC020200 mRNA Translation: AAH20200.1
AC004845 Genomic DNA No translation available.
AC004905 Genomic DNA No translation available.
AC005011 Genomic DNA No translation available.
AC006334 Genomic DNA No translation available.
AC067941 Genomic DNA No translation available.
AC092424 Genomic DNA No translation available.
AC092785 Genomic DNA No translation available.
CH471140 Genomic DNA Translation: EAX07902.1
CCDSiCCDS47603.1 [Q9BXU9-2]
CCDS5541.1 [Q9BXU9-1]
RefSeqiNP_001017440.1, NM_001017440.2 [Q9BXU9-1]
NP_113656.2, NM_031468.3 [Q9BXU9-2]
XP_011514897.1, XM_011516595.1
XP_011514898.1, XM_011516596.2 [Q9BXU9-1]
XP_011514899.1, XM_011516597.2 [Q9BXU9-1]
XP_011514901.1, XM_011516599.1 [Q9BXU9-1]
XP_016868164.1, XM_017012675.1 [Q9BXU9-2]
XP_016868165.1, XM_017012676.1 [Q9BXU9-2]
XP_016868167.1, XM_017012678.1 [Q9BXU9-1]
XP_016868168.1, XM_017012679.1 [Q9BXU9-1]
XP_016868169.1, XM_017012680.1 [Q9BXU9-1]
XP_016868170.1, XM_017012681.1 [Q9BXU9-1]
XP_016868171.1, XM_017012682.1 [Q9BXU9-1]
XP_016868172.1, XM_017012683.1 [Q9BXU9-1]
UniGeneiHs.592750

3D structure databases

ProteinModelPortaliQ9BXU9
SMRiQ9BXU9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123732, 1 interactor
IntActiQ9BXU9, 8 interactors
STRINGi9606.ENSP00000378690

PTM databases

PhosphoSitePlusiQ9BXU9

Polymorphism and mutation databases

BioMutaiCALN1
DMDMi20177867

Proteomic databases

PaxDbiQ9BXU9
PRIDEiQ9BXU9
ProteomicsDBi79523

Protocols and materials databases

DNASUi83698
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000329008; ENSP00000332498; ENSG00000183166 [Q9BXU9-1]
ENST00000395275; ENSP00000378690; ENSG00000183166 [Q9BXU9-2]
ENST00000395276; ENSP00000378691; ENSG00000183166 [Q9BXU9-1]
ENST00000431984; ENSP00000410704; ENSG00000183166 [Q9BXU9-1]
GeneIDi83698
KEGGihsa:83698
UCSCiuc003twa.5 human [Q9BXU9-1]

Organism-specific databases

CTDi83698
DisGeNETi83698
EuPathDBiHostDB:ENSG00000183166.10
GeneCardsiCALN1
HGNCiHGNC:13248 CALN1
HPAiHPA036278
HPA036708
MIMi607176 gene
neXtProtiNX_Q9BXU9
OpenTargetsiENSG00000183166
PharmGKBiPA26045
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0027 Eukaryota
COG5126 LUCA
GeneTreeiENSGT00740000115520
HOGENOMiHOG000252990
InParanoidiQ9BXU9
OMAiREKMPFH
OrthoDBiEOG091G0IMT
PhylomeDBiQ9BXU9
TreeFamiTF331025

Miscellaneous databases

ChiTaRSiCALN1 human
GeneWikiiCALN1
GenomeRNAii83698
PROiPR:Q9BXU9
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000183166 Expressed in 97 organ(s), highest expression level in cerebellum
CleanExiHS_CALN1
ExpressionAtlasiQ9BXU9 baseline and differential
GenevisibleiQ9BXU9 HS

Family and domain databases

CDDicd00051 EFh, 1 hit
InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
IPR001751 S100/CaBP-9k_CS
PfamiView protein in Pfam
PF13499 EF-hand_7, 1 hit
SMARTiView protein in SMART
SM00054 EFh, 2 hits
SUPFAMiSSF47473 SSF47473, 1 hit
PROSITEiView protein in PROSITE
PS00018 EF_HAND_1, 2 hits
PS50222 EF_HAND_2, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiCABP8_HUMAN
AccessioniPrimary (citable) accession number: Q9BXU9
Secondary accession number(s): J3KQA7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 16, 2002
Last sequence update: June 1, 2001
Last modified: November 7, 2018
This is version 141 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again