Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 166 (29 Sep 2021)
Sequence version 3 (29 Apr 2008)
Previous versions | rss
Add a publicationFeedback
Protein

RING finger protein 17

Gene

RNF17

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Seems to be involved in regulation of transcriptional activity of MYC. In vitro, inhibits DNA-binding activity of Mad-MAX heterodimers. Can recruit Mad transcriptional repressors (MXD1, MXD3, MXD4 and MXI1) to the cytoplasm. May be involved in spermiogenesis (By similarity).

By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri32 – 75RING-typePROSITE-ProRule annotationAdd BLAST44

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processDifferentiation, Spermatogenesis
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9BXT8

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
RING finger protein 17
Alternative name(s):
Tudor domain-containing protein 4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RNF17
Synonyms:TDRD4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 13

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:10060, RNF17

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605793, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BXT8

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000132972

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
56163

Open Targets

More...
OpenTargetsi
ENSG00000132972

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA34424

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9BXT8, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RNF17

Domain mapping of disease mutations (DMDM)

More...
DMDMi
187608889

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001831651 – 1623RING finger protein 17Add BLAST1623

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei234N6-acetyllysineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9BXT8

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9BXT8

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9BXT8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BXT8

PeptideAtlas

More...
PeptideAtlasi
Q9BXT8

PRoteomics IDEntifications database

More...
PRIDEi
Q9BXT8

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
79511 [Q9BXT8-3]
79512 [Q9BXT8-1]
79513 [Q9BXT8-2]
79514 [Q9BXT8-4]
79515 [Q9BXT8-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BXT8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BXT8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Testis specific.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000132972, Expressed in testis and 104 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9BXT8, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BXT8, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000132972, Tissue enriched (testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MXD1, MXD3, MXD4, MXI1 and PIWIL1. Self-associates (By similarity).

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
121096, 7 interactors

Protein interaction database and analysis system

More...
IntActi
Q9BXT8, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000255324

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9BXT8, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11623
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9BXT8

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9BXT8

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini726 – 784Tudor 1PROSITE-ProRule annotationAdd BLAST59
Domaini962 – 1021Tudor 2PROSITE-ProRule annotationAdd BLAST60
Domaini1228 – 1285Tudor 3PROSITE-ProRule annotationAdd BLAST58
Domaini1479 – 1539Tudor 4PROSITE-ProRule annotationAdd BLAST61

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 22DisorderedSequence analysisAdd BLAST22
Regioni1438 – 1462DisorderedSequence analysisAdd BLAST25

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri32 – 75RING-typePROSITE-ProRule annotationAdd BLAST44

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2039, Eukaryota
KOG2279, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157559

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_003202_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BXT8

Identification of Orthologs from Complete Genome Data

More...
OMAi
VWERGQI

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BXT8

Family and domain databases

Conserved Domains Database

More...
CDDi
cd04508, TUDOR, 4 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.40.50.90, 4 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR039117, RNF17
IPR035437, SNase_OB-fold_sf
IPR002999, Tudor
IPR001841, Znf_RING
IPR017907, Znf_RING_CS

The PANTHER Classification System

More...
PANTHERi
PTHR16442, PTHR16442, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00567, TUDOR, 5 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00333, TUDOR, 4 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50304, TUDOR, 4 hits
PS00518, ZF_RING_1, 1 hit
PS50089, ZF_RING_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BXT8-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAEASKTGP SRSSYQRMGR KSQPWGAAEI QCTRCGRRVS RSSGHHCELQ
60 70 80 90 100
CGHAFCELCL LMTEECTTII CPDCEVATAV NTRQRYYPMA GYIKEDSIME
110 120 130 140 150
KLQPKTIKNC SQDFKKTADQ LTTGLERSAS TDKTLLNSSA VMLDTNTAEE
160 170 180 190 200
IDEALNTAHH SFEQLSIAGK ALEHMQKQTI EERERVIEVV EKQFDQLLAF
210 220 230 240 250
FDSRKKNLCE EFARTTDDYL SNLIKAKSYI EEKKNNLNAA MNIARALQLS
260 270 280 290 300
PSLRTYCDLN QIIRTLQLTS DSELAQVSSP QLRNPPRLSV NCSEIICMFN
310 320 330 340 350
NMGKIEFRDS TKCYPQENEI RQNVQKKYNN KKELSCYDTY PPLEKKKVDM
360 370 380 390 400
SVLTSEAPPP PLQPETNDVH LEAKNFQPQK DVATASPKTI AVLPQMGSSP
410 420 430 440 450
DVIIEEIIED NVESSAELVF VSHVIDPCHF YIRKYSQIKD AKVLEKKVNE
460 470 480 490 500
FCNRSSHLDP SDILELGARI FVSSIKNGMW CRGTITELIP IEGRNTRKPC
510 520 530 540 550
SPTRLFVHEV ALIQIFMVDF GNSEVLIVTG VVDTHVRPEH SAKQHIALND
560 570 580 590 600
LCLVLRKSEP YTEGLLKDIQ PLAQPCSLKD IVPQNSNEGW EEEAKVEFLK
610 620 630 640 650
MVNNKAVSMK VFREEDGVLI VDLQKPPPNK ISSDMPVSLR DALVFMELAK
660 670 680 690 700
FKSQSLRSHF EKNTTLHYHP PILPKEMTDV SVTVCHINSP GDFYLQLIEG
710 720 730 740 750
LDILFLLKTI EEFYKSEDGE NLEILCPVQD QACVAKFEDG IWYRAKVIGL
760 770 780 790 800
PGHQEVEVKY VDFGNTAKIT IKDVRKIKDE FLNAPEKAIK CKLAYIEPYK
810 820 830 840 850
RTMQWSKEAK EKFEEKAQDK FMTCSVIKIL EDNVLLVELF DSLGAPEMTT
860 870 880 890 900
TSINDQLVKE GLASYEIGYI LKDNSQKHIE VWDPSPEEII SNEVHNLNPV
910 920 930 940 950
SAKSLPNENF QSLYNKELPV HICNVISPEK IYVQWLLTEN LLNSLEEKMI
960 970 980 990 1000
AAYENSKWEP VKWENDMHCA VKIQDKNQWR RGQIIRMVTD TLVEVLLYDV
1010 1020 1030 1040 1050
GVELVVNVDC LRKLEENLKT MGRLSLECSL VDIRPAGGSD KWTATACDCL
1060 1070 1080 1090 1100
SLYLTGAVAT IILQVDSEEN NTTWPLPVKI FCRDEKGERV DVSKYLIKKG
1110 1120 1130 1140 1150
LALRERRINN LDNSHSLSEK SLEVPLEQED SVVTNCIKTN FDPDKKTADI
1160 1170 1180 1190 1200
ISEQKVSEFQ EKILEPRTTR GYKPPAIPNM NVFEATVSCV GDDGTIFVVP
1210 1220 1230 1240 1250
KLSEFELIKM TNEIQSNLKC LGLLEPYFWK KGEACAVRGS DTLWYRGKVM
1260 1270 1280 1290 1300
EVVGGAVRVQ YLDHGFTEKI PQCHLYPILL YPDIPQFCIP CQLHNTTPVG
1310 1320 1330 1340 1350
NVWQPDAIEV LQQLLSKRQV DIHIMELPKN PWEKLSIHLY FDGMSLSYFM
1360 1370 1380 1390 1400
AYYKYCTSEH TEEMLKEKPR SDHDKKYEEE QWEIRFEELL SAETDTPLLP
1410 1420 1430 1440 1450
PYLSSSLPSP GELYAVQVKH VVSPNEVYIC LDSIETSNQS NQHSDTDDSG
1460 1470 1480 1490 1500
VSGESESESL DEALQRVNKK VEALPPLTDF RTEMPCLAEY DDGLWYRAKI
1510 1520 1530 1540 1550
VAIKEFNPLS ILVQFVDYGS TAKLTLNRLC QIPSHLMRYP ARAIKVLLAG
1560 1570 1580 1590 1600
FKPPLRDLGE TRIPYCPKWS MEALWAMIDC LQGKQLYAVS MAPAPEQIVT
1610 1620
LYDDEQHPVH MPLVEMGLAD KDE
Length:1,623
Mass (Da):184,643
Last modified:April 29, 2008 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3E710E6DD706CDF9
GO
Isoform 2 (identifier: Q9BXT8-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     651-653: FKS → DLI
     654-1623: Missing.

Show »
Length:653
Mass (Da):73,746
Checksum:i444C911E916D20CD
GO
Isoform 3 (identifier: Q9BXT8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     414-449: SSAELVFVSHVIDPCHFYIRKYSQIKDAKVLEKKVN → TCGTDDLGETPRYPKKPLQKNSSVPFGSKADTVTTV
     450-1623: Missing.

Show »
Length:449
Mass (Da):50,477
Checksum:i8F9E06F59E22DD6E
GO
Isoform 4 (identifier: Q9BXT8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1326-1368: ELPKNPWEKLSIHLYFDGMSLSYFMAYYKYCTSEHTEEMLKEK → K

Show »
Length:1,581
Mass (Da):179,508
Checksum:iE290A64D77F3578B
GO
Isoform 5 (identifier: Q9BXT8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1320-1325: Missing.

Show »
Length:1,617
Mass (Da):183,935
Checksum:i8D65E390C2828F2A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5T6R1Q5T6R1_HUMAN
RING finger protein 17
RNF17
633Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5T2J8Q5T2J8_HUMAN
RING finger protein 17
RNF17
855Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH64847 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA91972 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti361P → S in AAK31981 (PubMed:11279525).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_024613346K → N. Corresponds to variant dbSNP:rs1451568Ensembl.1
Natural variantiVAR_028132467G → S. Corresponds to variant dbSNP:rs9581180Ensembl.1
Natural variantiVAR_028133501S → G. Corresponds to variant dbSNP:rs9507413EnsemblClinVar.1
Natural variantiVAR_052098573A → P. Corresponds to variant dbSNP:rs10161760Ensembl.1
Natural variantiVAR_052099667H → R. Corresponds to variant dbSNP:rs9511451Ensembl.1
Natural variantiVAR_0521001110N → K. Corresponds to variant dbSNP:rs3783082Ensembl.1
Natural variantiVAR_0521011380E → K2 PublicationsCorresponds to variant dbSNP:rs9507425Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_005753414 – 449SSAEL…EKKVN → TCGTDDLGETPRYPKKPLQK NSSVPFGSKADTVTTV in isoform 3. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_005754450 – 1623Missing in isoform 3. 1 PublicationAdd BLAST1174
Alternative sequenceiVSP_033073651 – 653FKS → DLI in isoform 2. 1 Publication3
Alternative sequenceiVSP_033074654 – 1623Missing in isoform 2. 1 PublicationAdd BLAST970
Alternative sequenceiVSP_0330751320 – 1325Missing in isoform 5. 1 Publication6
Alternative sequenceiVSP_0330761326 – 1368ELPKN…MLKEK → K in isoform 4. 1 PublicationAdd BLAST43

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF285602 mRNA Translation: AAK31981.1
AF285603 mRNA Translation: AAK31982.1
AL354798 Genomic DNA No translation available.
AL391560 Genomic DNA No translation available.
BC064847 mRNA Translation: AAH64847.1 Different initiation.
AK001907 mRNA Translation: BAA91972.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS9308.2 [Q9BXT8-3]

NCBI Reference Sequences

More...
RefSeqi
NP_112567.2, NM_031277.2 [Q9BXT8-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000255324; ENSP00000255324; ENSG00000132972 [Q9BXT8-3]
ENST00000255325; ENSP00000255325; ENSG00000132972 [Q9BXT8-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
56163

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:56163

UCSC genome browser

More...
UCSCi
uc001upr.4, human [Q9BXT8-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF285602 mRNA Translation: AAK31981.1
AF285603 mRNA Translation: AAK31982.1
AL354798 Genomic DNA No translation available.
AL391560 Genomic DNA No translation available.
BC064847 mRNA Translation: AAH64847.1 Different initiation.
AK001907 mRNA Translation: BAA91972.1 Different initiation.
CCDSiCCDS9308.2 [Q9BXT8-3]
RefSeqiNP_112567.2, NM_031277.2 [Q9BXT8-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EQKNMR-A949-1026[»]
SMRiQ9BXT8
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi121096, 7 interactors
IntActiQ9BXT8, 3 interactors
STRINGi9606.ENSP00000255324

PTM databases

iPTMnetiQ9BXT8
PhosphoSitePlusiQ9BXT8

Genetic variation databases

BioMutaiRNF17
DMDMi187608889

Proteomic databases

EPDiQ9BXT8
jPOSTiQ9BXT8
MassIVEiQ9BXT8
PaxDbiQ9BXT8
PeptideAtlasiQ9BXT8
PRIDEiQ9BXT8
ProteomicsDBi79511 [Q9BXT8-3]
79512 [Q9BXT8-1]
79513 [Q9BXT8-2]
79514 [Q9BXT8-4]
79515 [Q9BXT8-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
22496, 73 antibodies

The DNASU plasmid repository

More...
DNASUi
56163

Genome annotation databases

EnsembliENST00000255324; ENSP00000255324; ENSG00000132972 [Q9BXT8-3]
ENST00000255325; ENSP00000255325; ENSG00000132972 [Q9BXT8-1]
GeneIDi56163
KEGGihsa:56163
UCSCiuc001upr.4, human [Q9BXT8-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
56163
DisGeNETi56163

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RNF17
HGNCiHGNC:10060, RNF17
HPAiENSG00000132972, Tissue enriched (testis)
MIMi605793, gene
neXtProtiNX_Q9BXT8
OpenTargetsiENSG00000132972
PharmGKBiPA34424
VEuPathDBiHostDB:ENSG00000132972

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2039, Eukaryota
KOG2279, Eukaryota
GeneTreeiENSGT00940000157559
HOGENOMiCLU_003202_1_0_1
InParanoidiQ9BXT8
OMAiVWERGQI
PhylomeDBiQ9BXT8

Enzyme and pathway databases

PathwayCommonsiQ9BXT8

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
56163, 5 hits in 1042 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
RNF17, human
EvolutionaryTraceiQ9BXT8

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
56163
PharosiQ9BXT8, Tbio

Protein Ontology

More...
PROi
PR:Q9BXT8
RNActiQ9BXT8, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000132972, Expressed in testis and 104 other tissues
ExpressionAtlasiQ9BXT8, baseline and differential
GenevisibleiQ9BXT8, HS

Family and domain databases

CDDicd04508, TUDOR, 4 hits
Gene3Di2.40.50.90, 4 hits
InterProiView protein in InterPro
IPR039117, RNF17
IPR035437, SNase_OB-fold_sf
IPR002999, Tudor
IPR001841, Znf_RING
IPR017907, Znf_RING_CS
PANTHERiPTHR16442, PTHR16442, 1 hit
PfamiView protein in Pfam
PF00567, TUDOR, 5 hits
SMARTiView protein in SMART
SM00333, TUDOR, 4 hits
PROSITEiView protein in PROSITE
PS50304, TUDOR, 4 hits
PS00518, ZF_RING_1, 1 hit
PS50089, ZF_RING_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRNF17_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BXT8
Secondary accession number(s): Q5T2J9
, Q6P1W3, Q9BXT7, Q9NUY9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 24, 2001
Last sequence update: April 29, 2008
Last modified: September 29, 2021
This is version 166 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again