Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 150 (18 Sep 2019)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

RNA helicase Mov10l1

Gene

MOV10L1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

ATP-dependent RNA helicase required during spermatogenesis to repress transposable elements and prevent their mobilization, which is essential for germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governs the methylation and subsequent repression of transposons. Involved in the primary piRNA metabolic process. Specifically binds to piRNA precursors and promotes the generation of intermediate piRNA processing fragments that are subsequently loaded to Piwi proteins. Acts via its ATP-dependent RNA helicase activity: displays 5'-3' RNA unwinding activity and probably mediates unwinding and funneling of single-stranded piRNA precursor transcripts to the endonuclease that catalyzes the first cleavage step of piRNA processing to generate piRNA intermediate fragments that are subsequently loaded to Piwi proteins.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi770 – 777ATPSequence analysis8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, Helicase, Hydrolase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5601884 PIWI-interacting RNA (piRNA) biogenesis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
RNA helicase Mov10l1Curated (EC:3.6.4.13By similarity)
Alternative name(s):
Moloney leukemia virus 10-like protein 1Imported
Short name:
MOV10-like protein 1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MOV10L1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 22

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7201 MOV10L1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605794 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BXT6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
54456

Open Targets

More...
OpenTargetsi
ENSG00000073146

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30909

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MOV10L1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
22095856

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000807061 – 1211RNA helicase Mov10l1Add BLAST1211

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9BXT6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BXT6

PeptideAtlas

More...
PeptideAtlasi
Q9BXT6

PRoteomics IDEntifications database

More...
PRIDEi
Q9BXT6

ProteomicsDB human proteome resource

More...
ProteomicsDBi
2313
26428
79508 [Q9BXT6-1]
79509 [Q9BXT6-2]
79510 [Q9BXT6-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BXT6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BXT6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1: Specifically expressed in testis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000073146 Expressed in 91 organ(s), highest expression level in right testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9BXT6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BXT6 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA019034

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PIWIL1.

Interacts with PIWIL2.

Interacts with PIWIL4.

Interacts with HSPA2.

Interacts with PLD6.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119963, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000262794

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi886 – 889DEAG box4

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1804 Eukaryota
COG1112 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160150

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000015363

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BXT6

KEGG Orthology (KO)

More...
KOi
K13983

Identification of Orthologs from Complete Genome Data

More...
OMAi
NMSGVTL

Database of Orthologous Groups

More...
OrthoDBi
286011at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BXT6

TreeFam database of animal gene trees

More...
TreeFami
TF323999

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR041679 DNA2/NAM7-like_AAA
IPR041677 DNA2/NAM7_AAA_11
IPR027417 P-loop_NTPase

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF13086 AAA_11, 2 hits
PF13087 AAA_12, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540 SSF52540, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 5 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BXT6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLSLAAKLVA FFWRTADTPR EEAGQLEPEL AEGDTKLKTV RGVVTRYCSD
60 70 80 90 100
YGMIDDMIYF SSDAVTSRVL LNVGQEVIAV VEENKVSNGL KAIRVEAVSD
110 120 130 140 150
KWEDDSRNHG SPSDCGPRVL IGCVTSLVEG AGCISQTTYF SLESVCEGFE
160 170 180 190 200
PCKGDWVEAE YRIRPGTWSS EATSVKPLRY KRVDKVCISS LCGRNGVLEE
210 220 230 240 250
SIFFTLDSLK LPDGYTPRRG DVVNAVVVES SQSCYVWRAL CMTLVKRRDA
260 270 280 290 300
APVHEATHFY GTILLKNKGD IEVTQVTHFG TLKEGRSKTM VIWIENKGDI
310 320 330 340 350
PQNLVSCKLA GWDKSKQFRF QMLDKDQMCP VVSFVSVPEK ENSSDENINS
360 370 380 390 400
LNSHTKNKTS QMSESSLVNN RGISPGDCTC KGENGEKDNI LSRKQMTEPE
410 420 430 440 450
PGGLVPPGGK TFIVVICDGK NPGRCKELLL LCFSDFLIGR YLEVNVISGE
460 470 480 490 500
ESLIAAREPF SWKKLKSSQA LTSAKTTVVV TAQKRNSRRQ LPSFLPQYPI
510 520 530 540 550
PDRLRKCVEQ KIDILTFQPL LAELLNMSNY KEKFSTLLWL EEIYAEMELK
560 570 580 590 600
EYNMSGIILR RNGDLLVLEV PGLAEGRPSL YAGDKLILKT QEYNGHAIEY
610 620 630 640 650
ISYVTEIHEE DVTLKINPEF EQAYNFEPMD VEFTYNRTTS RRCHFALEHV
660 670 680 690 700
IHLGVKVLFP EEIILQSPQV TGNWNHAQDT KSSGQSTSKK NRKTMTDQAE
710 720 730 740 750
HGTEERRVGD KDLPVLAPFT AEMSDWVDEI QTPKARKMEF FNPVLNENQK
760 770 780 790 800
LAVKRILSGD CRPLPYILFG PPGTGKTVTI IEAVLQVHFA LPDSRILVCA
810 820 830 840 850
PSNSAADLVC LRLHESKVLQ PATMVRVNAT CRFEEIVIDA VKPYCRDGED
860 870 880 890 900
IWKASRFRII ITTCSSSGLF YQIGVRVGHF THVFVDEAGQ ASEPECLIPL
910 920 930 940 950
GLMSDISGQI VLAGDPMQLG PVIKSRLAMA YGLNVSFLER LMSRPAYQRD
960 970 980 990 1000
ENAFGACGAH NPLLVTKLVK NYRSHEALLM LPSRLFYHRE LEVCADPTVV
1010 1020 1030 1040 1050
TSLLGWEKLP KKGFPLIFHG VRGSEAREGK SPSWFNPAEA VQVLRYCCLL
1060 1070 1080 1090 1100
AHSISSQVSA SDIGVITPYR KQVEKIRILL RNVDLMDIKV GSVEEFQGQE
1110 1120 1130 1140 1150
YLVIIISTVR SNEDRFEDDR YFLGFLSNSK RFNVAITRPK ALLIVLGNPH
1160 1170 1180 1190 1200
VLVRDPCFGA LLEYSITNGV YMGCDLPPAL QSLQNCGEGV ADPSYPVVPE
1210
STGPEKHQEP S
Length:1,211
Mass (Da):135,293
Last modified:June 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i410716BDCC85F8B1
GO
Isoform 2 (identifier: Q9BXT6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-873: Missing.
     874-875: GV → MF

Show »
Length:338
Mass (Da):37,504
Checksum:i36393089E7038F73
GO
Isoform 3 (identifier: Q9BXT6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-902: Missing.
     910-964: Missing.
     1074-1082: EKIRILLRN → RPAQARLVL
     1083-1211: Missing.

Note: No experimental confirmation available.
Show »
Length:125
Mass (Da):13,978
Checksum:iFBC7AC28ECDC4A30
GO
Isoform 4 (identifier: Q9BXT6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1109-1154: Missing.

Note: No experimental confirmation available.
Show »
Length:1,165
Mass (Da):129,937
Checksum:i05600F89330D9C7E
GO
Isoform 5 (identifier: Q9BXT6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MLSLAAKLVAFFWRTADTPREEAGQLEPELAE → MSFLPVRSVIGG
     1155-1211: DPCFGALLEY...TGPEKHQEPS → LWRGGGRPLLPSGARIHRTREASGAQLICSG

Note: No experimental confirmation available.
Show »
Length:1,165
Mass (Da):130,229
Checksum:i508CFAEF64928B79
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C1D5H7C1D5_HUMAN
RNA helicase Mov10l1
MOV10L1
166Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F2Z2H1F2Z2H1_HUMAN
RNA helicase Mov10l1
MOV10L1
56Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti321Q → H in BAH13697 (PubMed:14702039).Curated1
Sequence conflicti1016L → P in BAH13697 (PubMed:14702039).Curated1
Sequence conflicti1063I → V in BAA90895 (PubMed:14702039).Curated1
Sequence conflicti1096F → L in BAA90895 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05945718T → S. Corresponds to variant dbSNP:rs12628964Ensembl.1
Natural variantiVAR_03410057M → L. Corresponds to variant dbSNP:rs9617066Ensembl.1
Natural variantiVAR_020148182R → C. Corresponds to variant dbSNP:rs3810971Ensembl.1
Natural variantiVAR_013694454I → L2 PublicationsCorresponds to variant dbSNP:rs760749Ensembl.1
Natural variantiVAR_013695650V → I. Corresponds to variant dbSNP:rs2340601Ensembl.1
Natural variantiVAR_034101683S → G. Corresponds to variant dbSNP:rs3736689Ensembl.1
Natural variantiVAR_013696820Q → R2 PublicationsCorresponds to variant dbSNP:rs2272837Ensembl.1
Natural variantiVAR_0136971179A → E1 PublicationCorresponds to variant dbSNP:rs2272843Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0109451 – 902Missing in isoform 3. 1 PublicationAdd BLAST902
Alternative sequenceiVSP_0033901 – 873Missing in isoform 2. 1 PublicationAdd BLAST873
Alternative sequenceiVSP_0460821 – 32MLSLA…PELAE → MSFLPVRSVIGG in isoform 5. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_003391874 – 875GV → MF in isoform 2. 1 Publication2
Alternative sequenceiVSP_010946910 – 964Missing in isoform 3. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_0109471074 – 1082EKIRILLRN → RPAQARLVL in isoform 3. 1 Publication9
Alternative sequenceiVSP_0109481083 – 1211Missing in isoform 3. 1 PublicationAdd BLAST129
Alternative sequenceiVSP_0454131109 – 1154Missing in isoform 4. 1 PublicationAdd BLAST46
Alternative sequenceiVSP_0460831155 – 1211DPCFG…HQEPS → LWRGGGRPLLPSGARIHRTR EASGAQLICSG in isoform 5. 1 PublicationAdd BLAST57

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF285604 mRNA Translation: AAK31983.1
AK000033 mRNA Translation: BAA90895.1
AK090740 mRNA Translation: BAC03511.1
AK302401 mRNA Translation: BAH13697.1
CR456466 mRNA Translation: CAG30352.1
AL022328 Genomic DNA No translation available.
AL034546 Genomic DNA No translation available.
BC150137 mRNA Translation: AAI50138.1
BC152539 mRNA Translation: AAI52540.1
AL133068 mRNA Translation: CAB61391.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14084.1 [Q9BXT6-1]
CCDS54541.1 [Q9BXT6-4]
CCDS54542.1 [Q9BXT6-5]
CCDS54543.1 [Q9BXT6-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
T42668

NCBI Reference Sequences

More...
RefSeqi
NP_001157576.1, NM_001164104.1 [Q9BXT6-4]
NP_001157577.1, NM_001164105.1 [Q9BXT6-5]
NP_001157578.1, NM_001164106.1 [Q9BXT6-2]
NP_061868.1, NM_018995.2 [Q9BXT6-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000262794; ENSP00000262794; ENSG00000073146 [Q9BXT6-1]
ENST00000354853; ENSP00000346917; ENSG00000073146 [Q9BXT6-3]
ENST00000395852; ENSP00000379193; ENSG00000073146 [Q9BXT6-2]
ENST00000395858; ENSP00000379199; ENSG00000073146 [Q9BXT6-4]
ENST00000540615; ENSP00000438542; ENSG00000073146 [Q9BXT6-5]
ENST00000545383; ENSP00000438978; ENSG00000073146 [Q9BXT6-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
54456

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:54456

UCSC genome browser

More...
UCSCi
uc003bjj.4 human [Q9BXT6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF285604 mRNA Translation: AAK31983.1
AK000033 mRNA Translation: BAA90895.1
AK090740 mRNA Translation: BAC03511.1
AK302401 mRNA Translation: BAH13697.1
CR456466 mRNA Translation: CAG30352.1
AL022328 Genomic DNA No translation available.
AL034546 Genomic DNA No translation available.
BC150137 mRNA Translation: AAI50138.1
BC152539 mRNA Translation: AAI52540.1
AL133068 mRNA Translation: CAB61391.1
CCDSiCCDS14084.1 [Q9BXT6-1]
CCDS54541.1 [Q9BXT6-4]
CCDS54542.1 [Q9BXT6-5]
CCDS54543.1 [Q9BXT6-2]
PIRiT42668
RefSeqiNP_001157576.1, NM_001164104.1 [Q9BXT6-4]
NP_001157577.1, NM_001164105.1 [Q9BXT6-5]
NP_001157578.1, NM_001164106.1 [Q9BXT6-2]
NP_061868.1, NM_018995.2 [Q9BXT6-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi119963, 2 interactors
STRINGi9606.ENSP00000262794

PTM databases

iPTMnetiQ9BXT6
PhosphoSitePlusiQ9BXT6

Polymorphism and mutation databases

BioMutaiMOV10L1
DMDMi22095856

Proteomic databases

EPDiQ9BXT6
PaxDbiQ9BXT6
PeptideAtlasiQ9BXT6
PRIDEiQ9BXT6
ProteomicsDBi2313
26428
79508 [Q9BXT6-1]
79509 [Q9BXT6-2]
79510 [Q9BXT6-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
54456
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262794; ENSP00000262794; ENSG00000073146 [Q9BXT6-1]
ENST00000354853; ENSP00000346917; ENSG00000073146 [Q9BXT6-3]
ENST00000395852; ENSP00000379193; ENSG00000073146 [Q9BXT6-2]
ENST00000395858; ENSP00000379199; ENSG00000073146 [Q9BXT6-4]
ENST00000540615; ENSP00000438542; ENSG00000073146 [Q9BXT6-5]
ENST00000545383; ENSP00000438978; ENSG00000073146 [Q9BXT6-1]
GeneIDi54456
KEGGihsa:54456
UCSCiuc003bjj.4 human [Q9BXT6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
54456
DisGeNETi54456

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MOV10L1
HGNCiHGNC:7201 MOV10L1
HPAiHPA019034
MIMi605794 gene
neXtProtiNX_Q9BXT6
OpenTargetsiENSG00000073146
PharmGKBiPA30909

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1804 Eukaryota
COG1112 LUCA
GeneTreeiENSGT00940000160150
HOGENOMiHOG000015363
InParanoidiQ9BXT6
KOiK13983
OMAiNMSGVTL
OrthoDBi286011at2759
PhylomeDBiQ9BXT6
TreeFamiTF323999

Enzyme and pathway databases

ReactomeiR-HSA-5601884 PIWI-interacting RNA (piRNA) biogenesis

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
54456

Pharos

More...
Pharosi
Q9BXT6

Protein Ontology

More...
PROi
PR:Q9BXT6

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000073146 Expressed in 91 organ(s), highest expression level in right testis
ExpressionAtlasiQ9BXT6 baseline and differential
GenevisibleiQ9BXT6 HS

Family and domain databases

InterProiView protein in InterPro
IPR041679 DNA2/NAM7-like_AAA
IPR041677 DNA2/NAM7_AAA_11
IPR027417 P-loop_NTPase
PfamiView protein in Pfam
PF13086 AAA_11, 2 hits
PF13087 AAA_12, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiM10L1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BXT6
Secondary accession number(s): A7E211
, A8MXC6, B7WPP1, B7Z7R1, F5H403, Q5TGD5, Q8NBD4, Q9NXW3, Q9UFB3, Q9UGX9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 2, 2002
Last sequence update: June 1, 2001
Last modified: September 18, 2019
This is version 150 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again