Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 151 (13 Feb 2019)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

C-type lectin domain family 7 member A

Gene

CLEC7A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Lectin that functions as pattern receptor specific for beta-1,3-linked and beta-1,6-linked glucans, such as cell wall constituents from pathogenic bacteria and fungi. Necessary for the TLR2-mediated inflammatory response and for TLR2-mediated activation of NF-kappa-B. Enhances cytokine production in macrophages and dendritic cells. Mediates production of reactive oxygen species in the cell. Mediates phagocytosis of C.albicans conidia. Binds T-cells in a way that does not involve their surface glycans and plays a role in T-cell activation. Stimulates T-cell proliferation (By similarity).By similarity3 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi157Divalent metal cationBy similarity1
Metal bindingi159Divalent metal cationBy similarity1
Metal bindingi163Divalent metal cationBy similarity1
Metal bindingi242Divalent metal cationBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor
Biological processImmunity, Inflammatory response, Innate immunity
LigandLectin, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5607764 CLEC7A (Dectin-1) signaling

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
C-type lectin domain family 7 member A
Alternative name(s):
Beta-glucan receptor
C-type lectin superfamily member 12
Dendritic cell-associated C-type lectin 1
Short name:
DC-associated C-type lectin 1
Short name:
Dectin-1
CD_antigen: CD369
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CLEC7A
Synonyms:BGR, CLECSF12, DECTIN1
ORF Names:UNQ539/PRO1082
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000172243.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14558 CLEC7A

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606264 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BXN2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 44CytoplasmicSequence analysisAdd BLAST44
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei45 – 65Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini66 – 247ExtracellularSequence analysisAdd BLAST182

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Candidiasis, familial, 4 (CANDF4)1 Publication
The disease may be caused by mutations affecting the gene represented in this entry.
Disease descriptionA primary immunodeficiency disorder with altered immune responses and impaired clearance of fungal infections, selective against Candida. It is characterized by persistent and/or recurrent infections of the skin, nails and mucous membranes caused by organisms of the genus Candida, mainly Candida albicans.
See also OMIM:613108

Organism-specific databases

DisGeNET

More...
DisGeNETi
64581

MalaCards human disease database

More...
MalaCardsi
CLEC7A
MIMi613108 phenotype
614079 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000172243

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
1334 Chronic mucocutaneous candidiasis

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26581

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2034810

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CLEC7A

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74752433

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002694911 – 247C-type lectin domain family 7 member AAdd BLAST247

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi91N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi120 ↔ 131PROSITE-ProRule annotation
Disulfide bondi148 ↔ 241PROSITE-ProRule annotation
Disulfide bondi220 ↔ 233PROSITE-ProRule annotation

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on tyrosine residues in response to glucan binding.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9BXN2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BXN2

PeptideAtlas

More...
PeptideAtlasi
Q9BXN2

PRoteomics IDEntifications database

More...
PRIDEi
Q9BXN2

ProteomicsDB human proteome resource

More...
ProteomicsDBi
79462
79463 [Q9BXN2-2]
79464 [Q9BXN2-3]
79465 [Q9BXN2-4]
79466 [Q9BXN2-5]
79467 [Q9BXN2-6]
79468 [Q9BXN2-7]
79469 [Q9BXN2-8]
79470 [Q9BXN2-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BXN2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BXN2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in peripheral blood leukocytes and dendritic cells. Detected in spleen, bone marrow, lung, muscle, stomach and placenta.5 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated during differentiation from monocytes into dendritic cells.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000172243 Expressed in 192 organ(s), highest expression level in blood

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9BXN2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BXN2 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA043244
HPA050229

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer (By similarity). Interacts with SYK; participates in leukocyte activation in presence of fungal pathogens (By similarity). Isoform 5 interacts with RANBP9.By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122206, 22 interactors

Database of interacting proteins

More...
DIPi
DIP-61730N

Protein interaction database and analysis system

More...
IntActi
Q9BXN2, 46 interactors

Molecular INTeraction database

More...
MINTi
Q9BXN2

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000302569

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9BXN2

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9BXN2

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini127 – 242C-type lectinPROSITE-ProRule annotationAdd BLAST116

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi15 – 18ITAM-like4

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4297 Eukaryota
ENOG410XPJ1 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161161

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000151249

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG105854

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BXN2

KEGG Orthology (KO)

More...
KOi
K10074

Identification of Orthologs from Complete Genome Data

More...
OMAi
SHNCVWI

Database of Orthologous Groups

More...
OrthoDBi
1201127at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BXN2

TreeFam database of animal gene trees

More...
TreeFami
TF336674

Family and domain databases

Conserved Domains Database

More...
CDDi
cd03593 CLECT_NK_receptors_like, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.10.100.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001304 C-type_lectin-like
IPR016186 C-type_lectin-like/link_sf
IPR016187 CTDL_fold
IPR033992 NKR-like_CTLD

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00059 Lectin_C, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00034 CLECT, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56436 SSF56436, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50041 C_TYPE_LECTIN_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (10+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 10 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 10 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BXN2-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEYHPDLENL DEDGYTQLHF DSQSNTRIAV VSEKGSCAAS PPWRLIAVIL
60 70 80 90 100
GILCLVILVI AVVLGTMAIW RSNSGSNTLE NGYFLSRNKE NHSQPTQSSL
110 120 130 140 150
EDSVTPTKAV KTTGVLSSPC PPNWIIYEKS CYLFSMSLNS WDGSKRQCWQ
160 170 180 190 200
LGSNLLKIDS SNELGFIVKQ VSSQPDNSFW IGLSRPQTEV PWLWEDGSTF
210 220 230 240
SSNLFQIRTT ATQENPSPNC VWIHVSVIYD QLCSVPSYSI CEKKFSM
Length:247
Mass (Da):27,627
Last modified:June 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i98393E36976111B9
GO
Isoform 2 (identifier: Q9BXN2-2) [UniParc]FASTAAdd to basket
Also known as: Beta, B

The sequence of this isoform differs from the canonical sequence as follows:
     68-113: Missing.

Note: Predominant isoform.
Show »
Length:201
Mass (Da):22,563
Checksum:iC6ADEE762B2CE968
GO
Isoform 3 (identifier: Q9BXN2-3) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     165-189: GFIVKQVSSQPDNSFWIGLSRPQTE → ISDQNHSYPRKPISKLCMDSRVSHL
     190-247: Missing.

Show »
Length:189
Mass (Da):21,065
Checksum:iF7DF9F76EA4B6B59
GO
Isoform 4 (identifier: Q9BXN2-4) [UniParc]FASTAAdd to basket
Also known as: G

The sequence of this isoform differs from the canonical sequence as follows:
     165-196: GFIVKQVSSQPDNSFWIGLSRPQTEVPWLWED → SLTLLPKLECSEAATSQAQVILPPQLPE
     197-247: Missing.

Show »
Length:192
Mass (Da):21,130
Checksum:i6F3350B1DFBEC921
GO
Isoform 5 (identifier: Q9BXN2-5) [UniParc]FASTAAdd to basket
Also known as: E

The sequence of this isoform differs from the canonical sequence as follows:
     36-114: Missing.

Show »
Length:168
Mass (Da):19,218
Checksum:iAFD3A88F89BBFFC6
GO
Isoform 6 (identifier: Q9BXN2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     68-113: Missing.
     165-178: GFIVKQVSSQPDNS → VSVDFCYDYLWCVS
     179-247: Missing.

Show »
Length:132
Mass (Da):14,787
Checksum:i997EEE918BC63102
GO
Isoform 7 (identifier: Q9BXN2-7) [UniParc]FASTAAdd to basket
Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     68-113: Missing.
     165-189: GFIVKQVSSQPDNSFWIGLSRPQTE → ISDQNHSYPRKPISKLCMDSRVSHL
     190-247: Missing.

Show »
Length:143
Mass (Da):16,000
Checksum:i3BD7AE116DDB4305
GO
Isoform 8 (identifier: Q9BXN2-8) [UniParc]FASTAAdd to basket
Also known as: F

The sequence of this isoform differs from the canonical sequence as follows:
     36-45: SCAASPPWRL → IYSKTSVFPT
     46-247: Missing.

Show »
Length:45
Mass (Da):5,164
Checksum:iED83111E8DE75169
GO
Isoform 9 (identifier: Q9BXN2-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-77: IWRSNSGSN → GFKAVEFKG
     78-247: Missing.

Note: No experimental confirmation available.
Show »
Length:77
Mass (Da):8,363
Checksum:i488D685E42698CCB
GO
Isoform 10 (identifier: Q9BXN2-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     68-116: AIWRSNSGSN...TKAVKTTGVL → GTGQFLKDLS...RTTVNPHNHL
     117-247: Missing.

Show »
Length:116
Mass (Da):13,138
Checksum:i8DE1C6BF8C69B3A9
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q68D78Q68D78_HUMAN
C-type lectin domain family 7 membe...
CLEC7A DKFZp686L24211
136Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti31V → I in AAL11714 (PubMed:11567029).Curated1

<p>This subsection of the ‘Sequence’ section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement_in_disease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

A stop polymorphism at position 238 may be associated with invasive aspergillosis following hematopoietic stem cell transplantation. The risk is highest when the polymorphism is present in both donors and recipients [MIMi:614079].

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_050111223I → S. Corresponds to variant dbSNP:rs16910527Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_02204836 – 114Missing in isoform 5. 2 PublicationsAdd BLAST79
Alternative sequenceiVSP_02204936 – 45SCAASPPWRL → IYSKTSVFPT in isoform 8. 1 Publication10
Alternative sequenceiVSP_02205046 – 247Missing in isoform 8. 1 PublicationAdd BLAST202
Alternative sequenceiVSP_04758968 – 116AIWRS…TTGVL → GTGQFLKDLSFLNNRRKLFG DPIQEATHWRMATFYQEIKR TTVNPHNHL in isoform 10. 1 PublicationAdd BLAST49
Alternative sequenceiVSP_02205168 – 113Missing in isoform 2, isoform 6 and isoform 7. 8 PublicationsAdd BLAST46
Alternative sequenceiVSP_04329869 – 77IWRSNSGSN → GFKAVEFKG in isoform 9. 1 Publication9
Alternative sequenceiVSP_04329978 – 247Missing in isoform 9. 1 PublicationAdd BLAST170
Alternative sequenceiVSP_047590117 – 247Missing in isoform 10. 1 PublicationAdd BLAST131
Alternative sequenceiVSP_022052165 – 196GFIVK…WLWED → SLTLLPKLECSEAATSQAQV ILPPQLPE in isoform 4. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_022053165 – 189GFIVK…RPQTE → ISDQNHSYPRKPISKLCMDS RVSHL in isoform 3 and isoform 7. 3 PublicationsAdd BLAST25
Alternative sequenceiVSP_022054165 – 178GFIVK…QPDNS → VSVDFCYDYLWCVS in isoform 6. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_022055179 – 247Missing in isoform 6. 1 PublicationAdd BLAST69
Alternative sequenceiVSP_022056190 – 247Missing in isoform 3 and isoform 7. 3 PublicationsAdd BLAST58
Alternative sequenceiVSP_022057197 – 247Missing in isoform 4. 1 PublicationAdd BLAST51

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY026769 mRNA Translation: AAK20114.2
AY026770 mRNA Translation: AAK20115.1
AY026771 mRNA Translation: AAK20116.1
AF313468 mRNA Translation: AAK37473.1
AF313469 mRNA Translation: AAK37474.1
AF400595 mRNA Translation: AAL11711.1
AF400596 mRNA Translation: AAL11712.1
AF400597 mRNA Translation: AAL11713.1
AF400598 mRNA Translation: AAL11714.1
AF400599 mRNA Translation: AAL11715.1
AF400600 mRNA Translation: AAL11716.1
AF400601 mRNA Translation: AAL11717.1
AF400602 mRNA Translation: AAL11718.1
AJ312372 mRNA Translation: CAC43846.1
AJ312373 mRNA Translation: CAC43847.1
AY009090 mRNA Translation: AAG33923.2
AY359002 mRNA Translation: AAQ89361.1
AK297028 mRNA Translation: BAH12480.1
AK298679 mRNA Translation: BAH12845.1
AK298724 mRNA Translation: BAH12855.1
AK313247 mRNA Translation: BAG36058.1
AC024224 Genomic DNA No translation available.
CH471094 Genomic DNA Translation: EAW96144.1
CH471094 Genomic DNA Translation: EAW96145.1
CH471094 Genomic DNA Translation: EAW96146.1
CH471094 Genomic DNA Translation: EAW96150.1
CH471094 Genomic DNA Translation: EAW96154.1
BC013385 mRNA Translation: AAH13385.1
BC071746 mRNA Translation: AAH71746.1
BC093829 mRNA Translation: AAH93829.1
BC093831 mRNA Translation: AAH93831.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41753.1 [Q9BXN2-1]
CCDS41754.1 [Q9BXN2-3]
CCDS53744.1 [Q9BXN2-7]
CCDS8613.1 [Q9BXN2-2]
CCDS8614.1 [Q9BXN2-5]
CCDS8617.1 [Q9BXN2-9]

NCBI Reference Sequences

More...
RefSeqi
NP_072092.2, NM_022570.4 [Q9BXN2-2]
NP_922938.1, NM_197947.2 [Q9BXN2-1]
NP_922939.1, NM_197948.2 [Q9BXN2-3]
NP_922940.1, NM_197949.2 [Q9BXN2-7]
NP_922941.1, NM_197950.2 [Q9BXN2-5]
NP_922945.1, NM_197954.2 [Q9BXN2-9]
XP_006719198.1, XM_006719135.3 [Q9BXN2-4]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.143929

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000298523; ENSP00000298523; ENSG00000172243 [Q9BXN2-7]
ENST00000304084; ENSP00000302569; ENSG00000172243 [Q9BXN2-1]
ENST00000310002; ENSP00000312089; ENSG00000172243 [Q9BXN2-9]
ENST00000349926; ENSP00000344723; ENSG00000172243 [Q9BXN2-8]
ENST00000353231; ENSP00000266456; ENSG00000172243 [Q9BXN2-2]
ENST00000396484; ENSP00000379743; ENSG00000172243 [Q9BXN2-5]
ENST00000465100; ENSP00000436923; ENSG00000172243 [Q9BXN2-10]
ENST00000529761; ENSP00000432876; ENSG00000172243 [Q9BXN2-1]
ENST00000531192; ENSP00000434392; ENSG00000172243 [Q9BXN2-4]
ENST00000533022; ENSP00000431461; ENSG00000172243 [Q9BXN2-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
64581

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:64581

UCSC genome browser

More...
UCSCi
uc001qxe.5 human [Q9BXN2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY026769 mRNA Translation: AAK20114.2
AY026770 mRNA Translation: AAK20115.1
AY026771 mRNA Translation: AAK20116.1
AF313468 mRNA Translation: AAK37473.1
AF313469 mRNA Translation: AAK37474.1
AF400595 mRNA Translation: AAL11711.1
AF400596 mRNA Translation: AAL11712.1
AF400597 mRNA Translation: AAL11713.1
AF400598 mRNA Translation: AAL11714.1
AF400599 mRNA Translation: AAL11715.1
AF400600 mRNA Translation: AAL11716.1
AF400601 mRNA Translation: AAL11717.1
AF400602 mRNA Translation: AAL11718.1
AJ312372 mRNA Translation: CAC43846.1
AJ312373 mRNA Translation: CAC43847.1
AY009090 mRNA Translation: AAG33923.2
AY359002 mRNA Translation: AAQ89361.1
AK297028 mRNA Translation: BAH12480.1
AK298679 mRNA Translation: BAH12845.1
AK298724 mRNA Translation: BAH12855.1
AK313247 mRNA Translation: BAG36058.1
AC024224 Genomic DNA No translation available.
CH471094 Genomic DNA Translation: EAW96144.1
CH471094 Genomic DNA Translation: EAW96145.1
CH471094 Genomic DNA Translation: EAW96146.1
CH471094 Genomic DNA Translation: EAW96150.1
CH471094 Genomic DNA Translation: EAW96154.1
BC013385 mRNA Translation: AAH13385.1
BC071746 mRNA Translation: AAH71746.1
BC093829 mRNA Translation: AAH93829.1
BC093831 mRNA Translation: AAH93831.1
CCDSiCCDS41753.1 [Q9BXN2-1]
CCDS41754.1 [Q9BXN2-3]
CCDS53744.1 [Q9BXN2-7]
CCDS8613.1 [Q9BXN2-2]
CCDS8614.1 [Q9BXN2-5]
CCDS8617.1 [Q9BXN2-9]
RefSeqiNP_072092.2, NM_022570.4 [Q9BXN2-2]
NP_922938.1, NM_197947.2 [Q9BXN2-1]
NP_922939.1, NM_197948.2 [Q9BXN2-3]
NP_922940.1, NM_197949.2 [Q9BXN2-7]
NP_922941.1, NM_197950.2 [Q9BXN2-5]
NP_922945.1, NM_197954.2 [Q9BXN2-9]
XP_006719198.1, XM_006719135.3 [Q9BXN2-4]
UniGeneiHs.143929

3D structure databases

ProteinModelPortaliQ9BXN2
SMRiQ9BXN2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122206, 22 interactors
DIPiDIP-61730N
IntActiQ9BXN2, 46 interactors
MINTiQ9BXN2
STRINGi9606.ENSP00000302569

Chemistry databases

ChEMBLiCHEMBL2034810

PTM databases

iPTMnetiQ9BXN2
PhosphoSitePlusiQ9BXN2

Polymorphism and mutation databases

BioMutaiCLEC7A
DMDMi74752433

Proteomic databases

jPOSTiQ9BXN2
PaxDbiQ9BXN2
PeptideAtlasiQ9BXN2
PRIDEiQ9BXN2
ProteomicsDBi79462
79463 [Q9BXN2-2]
79464 [Q9BXN2-3]
79465 [Q9BXN2-4]
79466 [Q9BXN2-5]
79467 [Q9BXN2-6]
79468 [Q9BXN2-7]
79469 [Q9BXN2-8]
79470 [Q9BXN2-9]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
64581
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000298523; ENSP00000298523; ENSG00000172243 [Q9BXN2-7]
ENST00000304084; ENSP00000302569; ENSG00000172243 [Q9BXN2-1]
ENST00000310002; ENSP00000312089; ENSG00000172243 [Q9BXN2-9]
ENST00000349926; ENSP00000344723; ENSG00000172243 [Q9BXN2-8]
ENST00000353231; ENSP00000266456; ENSG00000172243 [Q9BXN2-2]
ENST00000396484; ENSP00000379743; ENSG00000172243 [Q9BXN2-5]
ENST00000465100; ENSP00000436923; ENSG00000172243 [Q9BXN2-10]
ENST00000529761; ENSP00000432876; ENSG00000172243 [Q9BXN2-1]
ENST00000531192; ENSP00000434392; ENSG00000172243 [Q9BXN2-4]
ENST00000533022; ENSP00000431461; ENSG00000172243 [Q9BXN2-3]
GeneIDi64581
KEGGihsa:64581
UCSCiuc001qxe.5 human [Q9BXN2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
64581
DisGeNETi64581
EuPathDBiHostDB:ENSG00000172243.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CLEC7A

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0010422
HGNCiHGNC:14558 CLEC7A
HPAiHPA043244
HPA050229
MalaCardsiCLEC7A
MIMi606264 gene
613108 phenotype
614079 phenotype
neXtProtiNX_Q9BXN2
OpenTargetsiENSG00000172243
Orphaneti1334 Chronic mucocutaneous candidiasis
PharmGKBiPA26581

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4297 Eukaryota
ENOG410XPJ1 LUCA
GeneTreeiENSGT00940000161161
HOGENOMiHOG000151249
HOVERGENiHBG105854
InParanoidiQ9BXN2
KOiK10074
OMAiSHNCVWI
OrthoDBi1201127at2759
PhylomeDBiQ9BXN2
TreeFamiTF336674

Enzyme and pathway databases

ReactomeiR-HSA-5607764 CLEC7A (Dectin-1) signaling

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
CLEC7A

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
64581

Protein Ontology

More...
PROi
PR:Q9BXN2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000172243 Expressed in 192 organ(s), highest expression level in blood
ExpressionAtlasiQ9BXN2 baseline and differential
GenevisibleiQ9BXN2 HS

Family and domain databases

CDDicd03593 CLECT_NK_receptors_like, 1 hit
Gene3Di3.10.100.10, 1 hit
InterProiView protein in InterPro
IPR001304 C-type_lectin-like
IPR016186 C-type_lectin-like/link_sf
IPR016187 CTDL_fold
IPR033992 NKR-like_CTLD
PfamiView protein in Pfam
PF00059 Lectin_C, 1 hit
SMARTiView protein in SMART
SM00034 CLECT, 1 hit
SUPFAMiSSF56436 SSF56436, 1 hit
PROSITEiView protein in PROSITE
PS50041 C_TYPE_LECTIN_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCLC7A_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BXN2
Secondary accession number(s): B2R861
, B7Z494, B7Z5A9, B7Z5B9, Q6IPS7, Q96D32, Q96DR9, Q96LD3, Q96PA4, Q96PA5, Q96PA6, Q96PA7, Q96PA8, Q9H1K3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 12, 2006
Last sequence update: June 1, 2001
Last modified: February 13, 2019
This is version 151 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again