BBC3

Functionⁱ

Essential mediator of p53/TP53-dependent and p53/TP53-independent apoptosis (PubMed:11463391). Functions by promoting partial unfolding of BCL2L1 and dissociation of BCL2L1 from p53/TP53. Regulates ER stress-induced neuronal apoptosis (PubMed:23340338).2 Publications

GO - Biological processⁱ

activation of cysteine-type endopeptidase activity involved in apoptotic process
Source: UniProtKB
Inferred from direct assayⁱ
- 11463392
- 17024184
apoptotic signaling pathway
Source: UniProtKB
Inferred from direct assayⁱ
- 11463392
cellular response to DNA damage stimulus Source: BHF-UCL
cellular response to hypoxia
Source: UniProtKB
Inferred from expression patternⁱ
- 20810912
determination of adult lifespan Source: BHF-UCL
execution phase of apoptosis
Source: UniProtKB
Inferred from direct assayⁱ
- 11463391
- 11463392
intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress
Source: ParkinsonsUK-UCL
Inferred from direct assayⁱ
- 16407291
negative regulation of endoplasmic reticulum calcium ion concentration
Source: UniProtKB
Inferred from direct assayⁱ
- 17024184
negative regulation of growth
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 11463392
positive regulation of cysteine-type endopeptidase activity Source: UniProtKB
positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
Source: ParkinsonsUK-UCL
Traceable author statementⁱ
- 22013210
positive regulation of intrinsic apoptotic signaling pathway
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 17289999
positive regulation of IRE1-mediated unfolded protein response
Source: ParkinsonsUK-UCL
Traceable author statementⁱ
- 22013210
positive regulation of neuron apoptotic process Source: UniProtKB
positive regulation of protein homooligomerization
Source: UniProtKB
Inferred from direct assayⁱ
- 17024184
positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway
Source: UniProtKB
Inferred from direct assayⁱ
- 17024184
positive regulation of release of cytochrome c from mitochondria
Source: UniProtKB
Inferred from direct assayⁱ
- 17024184
positive regulation of thymocyte apoptotic process Source: BHF-UCL
protein insertion into mitochondrial membrane involved in apoptotic signaling pathway Source: Reactome
regulation of apoptotic process Source: Reactome
release of cytochrome c from mitochondria
Source: UniProtKB
Inferred from direct assayⁱ
- 11463392
release of sequestered calcium ion into cytosol
Source: UniProtKB
Inferred from direct assayⁱ
- 17024184
response to endoplasmic reticulum stress
Source: UniProtKB
Inferred from direct assayⁱ
- 22761832

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Biological process	Apoptosis

Biological process

Apoptosis

Enzyme and pathway databases

Reactomeⁱ	R-HSA-111453 BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members R-HSA-139915 Activation of PUMA and translocation to mitochondria R-HSA-6803204 TP53 Regulates Transcription of Genes Involved in Cytochrome C Release
SIGNORⁱ	Q9BXH1

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Bcl-2-binding component 3 Alternative name(s): JFY-1 p53 up-regulated modulator of apoptosis
Gene namesⁱ	Name:BBC3 Synonyms:PUMA
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 19

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000105327.15
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:17868 BBC3
MIMⁱ	605854 gene
neXtProtⁱ	NX_Q9BXH1

Keywords - Cellular componentⁱ

Mitochondrion

Pathology & Biotechⁱ

Mutagenesis

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Mutagenesisⁱ	133	W → A: Impairs p53/TP53-dependent apoptosis. 1 Publication		1
Mutagenesisⁱ	141 – 143	Missing : Abolishes BLC2-binding. Impairs growth inhibitory activity. No effect on mitochondrial subcellular location. 1 Publication		3

Organism-specific databases

DisGeNET More...DisGeNETⁱ	27113
Open Targets More...OpenTargetsⁱ	ENSG00000105327
PharmGKBⁱ	PA38471

Polymorphism and mutation databases

BioMutaⁱ	C10orf118
DMDMⁱ	56748610

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000143083	1 – 193	Bcl-2-binding component 3Add BLAST		193

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Modified residueⁱ	10	PhosphoserineCombined sources		1

Keywords - PTMⁱ

Phosphoprotein

Proteomic databases

EPDⁱ	Q9BXH1
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	Q9BXH1
PeptideAtlas More...PeptideAtlasⁱ	Q9BXH1
PRIDEⁱ	Q9BXH1
ProteomicsDBⁱ	79423 79424 [Q9BXH1-2]

PTM databases

iPTMnetⁱ	Q9BXH1
PhosphoSitePlusⁱ	Q9BXH1

Expressionⁱ

Tissue specificityⁱ

Ubiquitously expressed.1 Publication

Inductionⁱ

Up-regulated by TP53 (PubMed:11463392). Up-regulated by DNA damage, glucocorticoid treatment, growth factor deprivation and TP53 (PubMed:11572983). Up-regulated by ER stress in a DDIT3/CHOP-dependent manner (PubMed:22761832).3 Publications

Gene expression databases

Bgeeⁱ	ENSG00000105327 Expressed in 218 organ(s), highest expression level in dorsal plus ventral thalamus
CleanExⁱ	HS_BBC3
ExpressionAtlasⁱ	Q9BXH1 baseline and differential
Genevisibleⁱ	Q9BXH1 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	CAB007752 HPA070403

HPAⁱ

CAB007752
HPA070403

Interactionⁱ

Subunit structureⁱ

Interacts with MCL1 and BCL2A1 (By similarity). Interacts (via BH3 domain) with BCL2 (PubMed:11463391). Interacts with BCL2L1/BCL-XL (PubMed:23340338). Interacts (via BH3 domain) with NOL3/ARC (via CARD domain); this interaction prevents BBC3 association with BCL2 and results in CASP8 activation (By similarity).By similarity2 Publications

Binary interactionsⁱ

With	Entry	#Exp.	IntAct	Notes
BCL2	P10415	6	EBI-519884,EBI-77694
BCL2L1	Q07817-1	9	EBI-519884,EBI-287195
BCL2L2	Q92843	2	EBI-519884,EBI-707714
MCL1	Q07820	4	EBI-519884,EBI-1003422
Mcl1	P97287	5	EBI-519884,EBI-707292	From Mus musculus.

Protein-protein interaction databases

BioGridⁱ	118009, 7 interactors
ComplexPortalⁱ	CPX-1986 PUMA:BCL-2 complex CPX-1987 PUMA:BCL-XL complex
Database of interacting proteins More...DIPⁱ	DIP-29215N
IntActⁱ	Q9BXH1, 9 interactors
Molecular INTeraction database More...MINTⁱ	Q9BXH1

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Helixⁱ	133 – 150	Combined sources		18

Show more details

3D structure databases

ProteinModelPortalⁱ	Q9BXH1
SMRⁱ	Q9BXH1
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Motif

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Motifⁱ	137 – 151	BH3Add BLAST		15

Domainⁱ

The BH3 motif is intrinsically disordered.1 Publication

Sequence similaritiesⁱ

Belongs to the Bcl-2 family.Curated

Phylogenomic databases

Ensembl GeneTree More...GeneTreeⁱ	ENSGT00710000107236
HOGENOMⁱ	HOG000060256
HOVERGENⁱ	HBG050671
KEGG Orthology (KO) More...KOⁱ	K10132
PhylomeDBⁱ	Q9BXH1

Family and domain databases

InterProⁱ	View protein in InterPro IPR031661 Bbc3
PANTHERⁱ	PTHR28639 PTHR28639, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF15826 PUMA, 1 hit

Sequences (4)ⁱ

Sequence statusⁱ: Complete.

This entry describes 4 isoformsⁱ produced by alternative splicing. Align Add to basket

Isoform 1 (identifier: Q9BXH1-1) [UniParc]FASTA Add to basket

Also known as: PUMA alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MARARQEGSS PEPVEGLARD GPRPFPLGRL VPSAVSCGLC EPGLAAAPAA 
        60         70         80         90        100
PTLLPAAYLC APTAPPAVTA ALGGSRWPGG PRSRPRGPRP DGPQPSLSLA 
       110        120        130        140        150
EQHLESPVPS APGALAGGPT QAAPGVRGEE EQWAREIGAQ LRRMADDLNA 
       160        170        180        190 
QYERRRQEEQ QRHRPSPWRV LYNLIMGLLP LPRGHRAPEM EPN

Length:193

Mass (Da):20,532

Last modified:June 1, 2001 - v1

Checksum:ⁱ3585527F1858A4FA

GO

Isoform 2 (identifier: Q9BXH1-2) [UniParc]FASTA Add to basket

Also known as: PUMA beta

The sequence of this isoform differs from the canonical sequence as follows:
1-92: MARARQEGSS...SRPRGPRPDG → MKFGMGSAQACPCQVPRAASTTWVPCQICG

« Hide

        10         20         30         40         50
MKFGMGSAQA CPCQVPRAAS TTWVPCQICG PQPSLSLAEQ HLESPVPSAP 
        60         70         80         90        100
GALAGGPTQA APGVRGEEEQ WAREIGAQLR RMADDLNAQY ERRRQEEQQR 
       110        120        130 
HRPSPWRVLY NLIMGLLPLP RGHRAPEMEP N

Show »

Length:131

Mass (Da):14,459

Checksum:ⁱ674939670238F4AC

GO

Isoform 3 (identifier: Q96PG8-1) [UniParc]FASTA Add to basket

Also known as: PUMA delta

The sequence of this isoform can be found in the external entry Q96PG8.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

Length:101

Mass (Da):10,326

GO

Isoform 4 (identifier: Q96PG8-2) [UniParc]FASTA Add to basket

Also known as: PUMA gamma

The sequence of this isoform can be found in the external entry Q96PG8.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

Length:261

Mass (Da):26,498

GO

Alternative sequence

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Alternative sequenceⁱVSP_012238	1 – 92	MARAR…PRPDG → MKFGMGSAQACPCQVPRAAS TTWVPCQICG in isoform 2. 1 PublicationAdd BLAST		92

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF332558 mRNA Translation: AAK31316.1 AF354654 mRNA Translation: AAK39542.1 AF354655 mRNA Translation: AAK39543.1 U82987 mRNA Translation: AAB51243.2 CH471126 Genomic DNA Translation: EAW57465.1 BC136481 mRNA Translation: AAI36482.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS12697.1 [Q9BXH1-1] CCDS46130.1 [Q9BXH1-2]
NCBI Reference Sequences More...RefSeqⁱ	NP_001120712.1, NM_001127240.2 NP_001120713.1, NM_001127241.2 [Q9BXH1-2] NP_001120714.1, NM_001127242.2 NP_055232.1, NM_014417.4 [Q9BXH1-1] XP_006723204.1, XM_006723141.3 [Q9BXH1-1]
UniGeneⁱ	Hs.467020

Genome annotation databases

Ensemblⁱ	ENST00000341983; ENSP00000341155; ENSG00000105327 [Q9BXH1-2] ENST00000439096; ENSP00000395862; ENSG00000105327 [Q9BXH1-1]
GeneIDⁱ	27113
KEGGⁱ	hsa:27113
UCSC genome browser More...UCSCⁱ	uc002pgf.5 human [Q9BXH1-1]

Keywords - Coding sequence diversityⁱ

Alternative splicing

Similar proteinsⁱ

90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q9BXH1	Bcl-2-binding component 3	)	MOUSE		193	UniRef90_Q9BXH1
bcl-2-binding component 3 isoform X1		MESAU		209
Uncharacterized protein		CHLSB		199
Bcl-2-binding component 3		CASCN		193
bcl-2-binding component 3		LIPVE		193
+23
Q9BXH1-2	BBC3 isoform 2		PANTR		131	UniRef90_Q9BXH1-2
Uncharacterized protein		PROCO		131
Uncharacterized protein		SAIBB		131
Uncharacterized protein		MACMU		131
Uncharacterized protein		PAPAN		131
+11
Q96PG8-1	BBC3 isoform 3		PANTR		101	UniRef90_Q96PG8-1
Uncharacterized protein		SAIBB		101
Uncharacterized protein		MACMU		101
Uncharacterized protein		MACFA		101
Uncharacterized protein		MACNE		101
+11

Protein	Similar proteins		Species	Score	Length	Source
Q9BXH1	Bcl-2-binding component 3	)	MOUSE		193	UniRef50_Q9BXH1
Bcl-2-binding component 3		RAT		193
bcl-2-binding component 3 isoform X1		MESAU		209
Uncharacterized protein		CHLSB		199
Bcl-2-binding component 3		CASCN		193
+65
Q9BXH1-2	Uncharacterized protein		CERAT		131	UniRef50_Q9BXH1-2
Uncharacterized protein		PANPA		131
Uncharacterized protein		PROCO		131
Uncharacterized protein		MACMU		131
Uncharacterized protein		PAPAN		131
+22
Q96PG8-1	BBC3 isoform 4		PONAB		101	UniRef50_Q96PG8-1
Uncharacterized protein		RHIRO		101
Uncharacterized protein		Cebus capucinus imitator		101
Uncharacterized protein		GORGO		101
Uncharacterized protein		MACMU		101
+17

Cross-referencesⁱ

Web resourcesⁱ

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF332558 mRNA Translation: AAK31316.1 AF354654 mRNA Translation: AAK39542.1 AF354655 mRNA Translation: AAK39543.1 U82987 mRNA Translation: AAB51243.2 CH471126 Genomic DNA Translation: EAW57465.1 BC136481 mRNA Translation: AAI36482.1
CCDSⁱ	CCDS12697.1 [Q9BXH1-1] CCDS46130.1 [Q9BXH1-2]
RefSeqⁱ	NP_001120712.1, NM_001127240.2 NP_001120713.1, NM_001127241.2 [Q9BXH1-2] NP_001120714.1, NM_001127242.2 NP_055232.1, NM_014417.4 [Q9BXH1-1] XP_006723204.1, XM_006723141.3 [Q9BXH1-1]
UniGeneⁱ	Hs.467020

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	2M04	NMR	-	B	130-154	[»]
	4BPI	X-ray	1.98	B	136-152	[»]
	4BPJ	X-ray	1.60	D	139-153	[»]
	4BPK	X-ray	1.76	C/D	134-152	[»]
	4HNJ	X-ray	2.90	C	130-154	[»]
	5UUL	X-ray	1.33	B	132-154	[»]
ProteinModelPortalⁱ	Q9BXH1
SMRⁱ	Q9BXH1
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	118009, 7 interactors
ComplexPortalⁱ	CPX-1986 PUMA:BCL-2 complex CPX-1987 PUMA:BCL-XL complex
DIPⁱ	DIP-29215N
IntActⁱ	Q9BXH1, 9 interactors
MINTⁱ	Q9BXH1

PTM databases

iPTMnetⁱ	Q9BXH1
PhosphoSitePlusⁱ	Q9BXH1

Polymorphism and mutation databases

BioMutaⁱ	C10orf118
DMDMⁱ	56748610

Proteomic databases

EPDⁱ	Q9BXH1
MaxQBⁱ	Q9BXH1
PeptideAtlasⁱ	Q9BXH1
PRIDEⁱ	Q9BXH1
ProteomicsDBⁱ	79423 79424 [Q9BXH1-2]

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENST00000341983; ENSP00000341155; ENSG00000105327 [Q9BXH1-2] ENST00000439096; ENSP00000395862; ENSG00000105327 [Q9BXH1-1]
GeneIDⁱ	27113
KEGGⁱ	hsa:27113
UCSCⁱ	uc002pgf.5 human [Q9BXH1-1]

Organism-specific databases

CTDⁱ	27113
DisGeNETⁱ	27113
EuPathDBⁱ	HostDB:ENSG00000105327.15
GeneCardsⁱ	BBC3
HGNCⁱ	HGNC:17868 BBC3
HPAⁱ	CAB007752 HPA070403
MIMⁱ	605854 gene
neXtProtⁱ	NX_Q9BXH1
OpenTargetsⁱ	ENSG00000105327
PharmGKBⁱ	PA38471
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

GeneTreeⁱ	ENSGT00710000107236
HOGENOMⁱ	HOG000060256
HOVERGENⁱ	HBG050671
KOⁱ	K10132
PhylomeDBⁱ	Q9BXH1

Enzyme and pathway databases

Reactomeⁱ	R-HSA-111453 BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members R-HSA-139915 Activation of PUMA and translocation to mitochondria R-HSA-6803204 TP53 Regulates Transcription of Genes Involved in Cytochrome C Release
SIGNORⁱ	Q9BXH1

Miscellaneous databases

ChiTaRSⁱ	BBC3 human
GenomeRNAiⁱ	27113
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000105327 Expressed in 218 organ(s), highest expression level in dorsal plus ventral thalamus
CleanExⁱ	HS_BBC3
ExpressionAtlasⁱ	Q9BXH1 baseline and differential
Genevisibleⁱ	Q9BXH1 HS

Family and domain databases

InterProⁱ	View protein in InterPro IPR031661 Bbc3
PANTHERⁱ	PTHR28639 PTHR28639, 1 hit
Pfamⁱ	View protein in Pfam PF15826 PUMA, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	BBC3_HUMAN
Accessionⁱ	Q9BXH1Primary (citable) accession number: Q9BXH1 Secondary accession number(s): B9EGI3, O00171, Q96PG9
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	December 21, 2004
	Last sequence update:	June 1, 2001
	Last modified:	October 10, 2018
	This is version 139 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
Human chromosome 19
Human chromosome 19: entries, gene names and cross-references to MIM
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q9BXH1 (BBC3_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Bcl-2-binding component 3

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Mitochondrion

Cytosol

Endoplasmic reticulum

Mitochondrion

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Alternative sequence

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Web resourcesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ