Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sorbin and SH3 domain-containing protein 1

Gene

SORBS1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in tyrosine phosphorylation of CBL by linking CBL to the insulin receptor. Required for insulin-stimulated glucose transport. Involved in formation of actin stress fibers and focal adhesions (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • actin binding Source: ProtInc
  • cytoskeletal protein binding Source: ProtInc
  • insulin receptor binding Source: UniProtKB
  • SH3/SH2 adaptor activity Source: BHF-UCL

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processTransport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-445355 Smooth Muscle Contraction

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q9BX66

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9BX66

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sorbin and SH3 domain-containing protein 1
Alternative name(s):
Ponsin
SH3 domain protein 5
SH3P12
c-Cbl-associated protein
Short name:
CAP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SORBS1Imported
Synonyms:KIAA0894, KIAA1296, SH3D5
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000095637.21

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14565 SORBS1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605264 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BX66

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Cytoskeleton, Membrane, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
10580

Open Targets

More...
OpenTargetsi
ENSG00000095637

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA37899

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SORBS1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
317373504

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000721851 – 1292Sorbin and SH3 domain-containing protein 1Add BLAST1292

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei82PhosphothreonineBy similarity1
Modified residuei86PhosphoserineCombined sources1
Modified residuei89PhosphoserineCombined sources1
Modified residuei242PhosphoserineCombined sources1
Modified residuei259PhosphoserineCombined sources1
Modified residuei341PhosphoserineCombined sources1
Modified residuei344PhosphothreonineBy similarity1
Modified residuei350PhosphoserineCombined sources1
Modified residuei369PhosphoserineBy similarity1
Modified residuei374PhosphoserineBy similarity1
Modified residuei465PhosphoserineBy similarity1
Modified residuei472PhosphoserineCombined sources1
Modified residuei481PhosphoserineCombined sources1
Modified residuei536Phosphotyrosine; by ABL1By similarity1
Modified residuei556PhosphoserineCombined sources1
Modified residuei609PhosphoserineBy similarity1
Modified residuei640PhosphoserineBy similarity1
Modified residuei654Phosphotyrosine; by ABL1By similarity1
Modified residuei665PhosphoserineCombined sources1
Modified residuei708PhosphothreonineCombined sources1
Modified residuei713PhosphoserineBy similarity1
Modified residuei862PhosphothreonineCombined sources1
Modified residuei937PhosphotyrosineCombined sources1
Modified residuei945PhosphoserineCombined sources1
Modified residuei953PhosphoserineBy similarity1
Modified residuei1240Phosphotyrosine; by ABL1By similarity1
Isoform 41 Publication (identifier: Q9BX66-4)
Modified residuei105PhosphoserineCombined sources1
Modified residuei346PhosphoserineCombined sources1
Modified residuei603PhosphoserineCombined sources1
Isoform 81 Publication (identifier: Q9BX66-8)
Modified residuei114PhosphoserineCombined sources1
Modified residuei730PhosphoserineCombined sources1
Isoform 12 (identifier: Q9BX66-12)
Modified residuei114PhosphoserineCombined sources1
Modified residuei1213PhosphoserineCombined sources1
Isoform 61 Publication (identifier: Q9BX66-6)
Modified residuei137PhosphoserineCombined sources1
Modified residuei452PhosphoserineCombined sources1
Modified residuei765PhosphoserineCombined sources1
Isoform 9Curated (identifier: Q9BX66-9)
Modified residuei146PhosphoserineCombined sources1
Modified residuei387PhosphoserineCombined sources1
Modified residuei700PhosphoserineCombined sources1
Isoform 7Curated (identifier: Q9BX66-7)
Modified residuei469PhosphoserineCombined sources1
Isoform 10Curated (identifier: Q9BX66-10)
Modified residuei478PhosphoserineCombined sources1
Modified residuei735PhosphoserineCombined sources1
Isoform 51 Publication (identifier: Q9BX66-5)
Modified residuei923PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

O-glycosylated.By similarity

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9BX66

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9BX66

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BX66

PeptideAtlas

More...
PeptideAtlasi
Q9BX66

PRoteomics IDEntifications database

More...
PRIDEi
Q9BX66

ProteomicsDB human proteome resource

More...
ProteomicsDBi
79354
79355 [Q9BX66-10]
79356 [Q9BX66-11]
79357 [Q9BX66-12]
79358 [Q9BX66-2]
79359 [Q9BX66-3]
79360 [Q9BX66-4]
79361 [Q9BX66-5]
79362 [Q9BX66-6]
79363 [Q9BX66-7]
79364 [Q9BX66-8]
79365 [Q9BX66-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BX66

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BX66

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in skeletal muscle (at protein level). Widely expressed with highest levels in heart and skeletal muscle.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000095637 Expressed in 227 organ(s), highest expression level in blood vessel layer

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9BX66 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BX66 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA027559
HPA043084

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via third SH3 domain) with the Ten-1 ICD form of TENM1; the interaction induces the translocation of SORBS1 to the nucleus. Interacts with INSM1 (By similarity). Interacts with the long isoform of AFDN and with VCL. AFDN and VCL bind to SORBS1 in a competitive manner and do not form a ternary complex. Interacts with ABL1, CBL, CBLB and INPPL1/SHIP2 through the third SH3 domain. Interaction with ABL1 occurs only after insulin stimulation while this has no effect on the interaction with INPPL1. Interacts with the insulin receptor but dissociates from it following insulin stimulation. Also interacts with SCA7, PTK2/FAK1 and flotillin. Interacts (via SH3 domain 2) with PXN.By similarity4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115831, 38 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q9BX66

Protein interaction database and analysis system

More...
IntActi
Q9BX66, 37 interactors

Molecular INTeraction database

More...
MINTi
Q9BX66

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000355136

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11292
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9BX66

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9BX66

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q9BX66

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini366 – 469SoHoPROSITE-ProRule annotationAdd BLAST104
Domaini793 – 852SH3 1PROSITE-ProRule annotationAdd BLAST60
Domaini867 – 928SH3 2PROSITE-ProRule annotationAdd BLAST62
Domaini1231 – 1292SH3 3PROSITE-ProRule annotationAdd BLAST62

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4225 Eukaryota
ENOG410XNVJ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158658

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG053053

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BX66

KEGG Orthology (KO)

More...
KOi
K06086

Identification of Orthologs from Complete Genome Data

More...
OMAi
DYIDLPF

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0172

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BX66

TreeFam database of animal gene trees

More...
TreeFami
TF320680

Family and domain databases

Conserved Domains Database

More...
CDDi
cd11919 SH3_Sorbs1_1, 1 hit
cd11922 SH3_Sorbs1_2, 1 hit
cd11916 SH3_Sorbs1_3, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR003127 SoHo_dom
IPR028506 Sorbin_SH3
IPR035606 SORBS1_SH3
IPR035610 SORBS1_SH3_1
IPR035611 SORBS1_SH3_2

The PANTHER Classification System

More...
PANTHERi
PTHR45043 PTHR45043, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00018 SH3_1, 1 hit
PF07653 SH3_2, 1 hit
PF14604 SH3_9, 1 hit
PF02208 Sorb, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00326 SH3, 3 hits
SM00459 Sorb, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50044 SSF50044, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50002 SH3, 3 hits
PS50831 SOHO, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (12+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 12 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 12 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: Q9BX66-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSECDGGSK AVMNGLAPGS NGQDKATADP LRARSISAVK IIPVKTVKNA
60 70 80 90 100
SGLVLPTDMD LTKICTGKGA VTLRASSSYR ETPSSSPASP QETRQHESKP
110 120 130 140 150
GLEPEPSSAD EWRLSSSADA NGNAQPSSLA AKGYRSVHPN LPSDKSQDAT
160 170 180 190 200
SSSAAQPEVI VVPLYLVNTD RGQEGTARPP TPLGPLGCVP TIPATASAAS
210 220 230 240 250
PLTFPTLDDF IPPHLQRWPH HSQPARASGS FAPISQTPPS FSPPPPLVPP
260 270 280 290 300
APEDLRRVSE PDLTGAVSST DSSPLLNEVS SSLIGTDSQA FPSVSKPSSA
310 320 330 340 350
YPSTTIVNPT IVLLQHNREQ QKRLSSLSDP VSERRVGEQD SAPTQEKPTS
360 370 380 390 400
PGKAIEKRAK DDSRRVVKST QDLSDVSMDE VGIPLRNTER SKDWYKTMFK
410 420 430 440 450
QIHKLNRDTP EENPYFPTYK FPELPEIQQT SEEDNPYTPT YQFPASTPSP
460 470 480 490 500
KSEDDDSDLY SPRYSFSEDT KSPLSVPRSK SEMSYIDGEK VVKRSATLPL
510 520 530 540 550
PARSSSLKSS SERNDWEPPD KKVDTRKYRA EPKSIYEYQP GKSSVLTNEK
560 570 580 590 600
MSRDISPEEI DLKNEPWYKF FSELEFGKPP PKKIWDYTPG DCSILPREDR
610 620 630 640 650
KTNLDKDLSL CQTELEADLE KMETLNKAPS ANVPQSSAIS PTPEISSETP
660 670 680 690 700
GYIYSSNFHA VKRESDGAPG DLTSLENERQ IYKSVLEGGD IPLQGLSGLK
710 720 730 740 750
RPSSSASTKD SESPRHFIPA DYLESTEEFI RRRHDDKEKL LADQRRLKRE
760 770 780 790 800
QEEADIAARR HTGVIPTHHQ FITNERFGDL LNIDDTAKRK SGSEMRPARA
810 820 830 840 850
KFDFKAQTLK ELPLQKGDIV YIYKQIDQNW YEGEHHGRVG IFPRTYIELL
860 870 880 890 900
PPAEKAQPKK LTPVQVLEYG EAIAKFNFNG DTQVEMSFRK GERITLLRQV
910 920 930 940 950
DENWYEGRIP GTSRQGIFPI TYVDVIKRPL VKNPVDYMDL PFSSSPSRSA
960 970 980 990 1000
TASPQFSSHS KLITPAPSSL PHSRRALSPE MHAVTSEWIS LTVGVPGRRS
1010 1020 1030 1040 1050
LALTPPLPPL PEASIYNTDH LALSPRASPS LSLSLPHLSW SDRPTPRSVA
1060 1070 1080 1090 1100
SPLALPSPHK TYSLAPTSQA SLHMNGDGGV HTPSSGIHQD SFLQLPLGSS
1110 1120 1130 1140 1150
DSVISQLSDA FSSQSKRQPW REESGQYERK AERGAGERGP GGPKISKKSC
1160 1170 1180 1190 1200
LKPSDVVRCL STEQRLSDLN TPEESRPGKP LGSAFPGSEA EQTERHRGGE
1210 1220 1230 1240 1250
QAGRKAARRG GSQQPQAQQR RVTPDRSQTS QDLFSYQALY SYIPQNDDEL
1260 1270 1280 1290
ELRDGDIVDV MEKCDDGWFV GTSRRTKQFG TFPGNYVKPL YL
Length:1,292
Mass (Da):142,513
Last modified:January 11, 2011 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i70DA4169B6D82F06
GO
Isoform 21 Publication (identifier: Q9BX66-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     434-453: DNPYTPTYQFPASTPSPKSE → TKSCSVMSPRLECSGTVIAHCSLKLLDSSNPPTSASQVAGTA
     955-1117: Missing.

Show »
Length:1,151
Mass (Da):127,276
Checksum:iC1BD7AD5D5BE1300
GO
Isoform 31 Publication (identifier: Q9BX66-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     147-215: Missing.
     408-453: Missing.
     602-635: Missing.
     956-975: FSSHSKLITPAPSSLPHSRR → LSHHSLRAGPDLTESEKSYV
     976-1213: Missing.

Show »
Length:905
Mass (Da):101,082
Checksum:iC44DB4C9B0526933
GO
Isoform 41 Publication (identifier: Q9BX66-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     26-57: Missing.
     101-109: Missing.
     148-270: Missing.
     408-453: Missing.
     552-635: Missing.
     738-793: Missing.
     955-1212: Missing.

Show »
Length:684
Mass (Da):76,596
Checksum:i9A417161477CB810
GO
Isoform 51 Publication (identifier: Q9BX66-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     101-109: Missing.
     431-451: Missing.
     955-1212: Missing.

Show »
Length:1,004
Mass (Da):111,791
Checksum:i45A17463F7373E8B
GO
Isoform 61 Publication (identifier: Q9BX66-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     101-109: Missing.
     148-270: Missing.
     580-635: Missing.
     955-1212: Missing.

Show »
Length:846
Mass (Da):95,036
Checksum:i61FC1B8026A7D9A1
GO
Isoform 7Curated (identifier: Q9BX66-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     26-57: Missing.
     101-109: Missing.
     408-453: Missing.
     552-635: Missing.
     795-799: MRPAR → KYDWA
     800-1292: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:628
Mass (Da):68,745
Checksum:i4B5BD67EF6355537
GO
Isoform 81 Publication (identifier: Q9BX66-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     26-57: Missing.
     148-270: Missing.
     408-453: Missing.
     580-601: Missing.
     955-1212: Missing.

Show »
Length:811
Mass (Da):91,055
Checksum:i019F4E7E811AFDF5
GO
Isoform 9Curated (identifier: Q9BX66-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     148-270: Missing.
     408-453: Missing.
     552-635: Missing.
     955-1212: Missing.

Show »
Length:781
Mass (Da):87,199
Checksum:iEDB752BF6DB3E4E1
GO
Isoform 10Curated (identifier: Q9BX66-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     26-57: Missing.
     408-453: Missing.
     552-635: Missing.
     738-793: Missing.
     955-1212: Missing.

Note: No experimental confirmation available.Combined sources
Show »
Length:816
Mass (Da):90,218
Checksum:i490FCF5615BF69DB
GO
Isoform 11 (identifier: Q9BX66-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     408-453: Missing.
     1213-1213: Q → QLSHHSLRAGPDLTESEKSYV

Show »
Length:1,266
Mass (Da):139,401
Checksum:i857F07CDCB13B97E
GO
Isoform 12 (identifier: Q9BX66-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     26-57: Missing.
     148-270: Missing.
     319-328: Missing.
     408-453: Missing.
     580-601: Missing.
     709-709: K → KVDRKGGNAH...PQSELAPSRG
     955-1212: Missing.

Note: No experimental confirmation available. Derived from mouse ortholog data.Combined sources
Show »
Length:1,294
Mass (Da):143,741
Checksum:i770EBDC6412A6C03
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
S4R303S4R303_HUMAN
Sorbin and SH3 domain-containing pr...
SORBS1
393Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RQI5A0A0U1RQI5_HUMAN
Sorbin and SH3 domain-containing pr...
SORBS1
507Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5T925Q5T925_HUMAN
Sorbin and SH3 domain-containing pr...
SORBS1
186Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R406S4R406_HUMAN
Sorbin and SH3 domain-containing pr...
SORBS1
145Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB93496 differs from that shown. Reason: Frameshift at positions 861, 867 and 885.Curated
The sequence BAA92534 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti9S → P in CAJ97431 (PubMed:17462669).Curated1
Sequence conflicti18P → S in AAD27647 (PubMed:11374898).Curated1
Sequence conflicti18P → S in AAF22175 (PubMed:11532984).Curated1
Sequence conflicti110D → G in AAD27647 (PubMed:11374898).Curated1
Sequence conflicti110D → G in AAF22175 (PubMed:11532984).Curated1
Sequence conflicti113R → K in AAD27647 (PubMed:11374898).Curated1
Sequence conflicti113R → K in AAF22175 (PubMed:11532984).Curated1
Sequence conflicti131A → V in AAD27647 (PubMed:11374898).Curated1
Sequence conflicti131A → V in AAF22175 (PubMed:11532984).Curated1
Sequence conflicti134Y → S in AAD27647 (PubMed:11374898).Curated1
Sequence conflicti134Y → S in AAF22175 (PubMed:11532984).Curated1
Sequence conflicti226 – 228RAS → SAC in AAF22175 (PubMed:11532984).Curated3
Sequence conflicti264T → P in AAF22175 (PubMed:11532984).Curated1
Sequence conflicti292 – 295PSVS → SSEC in AAD27647 (PubMed:11374898).Curated4
Sequence conflicti292 – 295PSVS → SSEC in AAF22175 (PubMed:11532984).Curated4
Sequence conflicti481S → R in AAF22175 (PubMed:11532984).Curated1
Sequence conflicti489E → V in AAD27647 (PubMed:11374898).Curated1
Sequence conflicti489E → V in AAF22175 (PubMed:11532984).Curated1
Sequence conflicti607D → E in AAF22175 (PubMed:11532984).Curated1
Sequence conflicti610L → F in AAF22175 (PubMed:11532984).Curated1
Sequence conflicti644E → G in AAD27647 (PubMed:11374898).Curated1
Sequence conflicti644E → G in AAF22175 (PubMed:11532984).Curated1
Sequence conflicti679R → S in AAD27647 (PubMed:11374898).Curated1
Sequence conflicti679R → S in AAF22175 (PubMed:11532984).Curated1
Sequence conflicti690D → V in AAD27647 (PubMed:11374898).Curated1
Sequence conflicti690D → V in AAF22175 (PubMed:11532984).Curated1
Sequence conflicti694Q → R in CAJ97431 (PubMed:17462669).Curated1
Sequence conflicti695G → D in AAD27647 (PubMed:11374898).Curated1
Sequence conflicti695G → D in AAF22175 (PubMed:11532984).Curated1
Sequence conflicti710D → N in AAD27647 (PubMed:11374898).Curated1
Sequence conflicti710D → N in AAF22175 (PubMed:11532984).Curated1
Sequence conflicti1156V → G in AAK37563 (PubMed:11374898).Curated1
Sequence conflicti1156V → G in AAK37564 (PubMed:11374898).Curated1
Isoform 21 Publication (identifier: Q9BX66-2)
Sequence conflicti435K → E in AAK37564 (PubMed:11374898).Curated1
Sequence conflicti452 – 455AHCS → SRCG in AAK37564 (PubMed:11374898).Curated4
Sequence conflicti463N → D in AAK37564 (PubMed:11374898).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04765261L → P8 PublicationsCorresponds to variant dbSNP:rs943542Ensembl.1
Natural variantiVAR_01965374R → W1 PublicationCorresponds to variant dbSNP:rs757431022Ensembl.1
Natural variantiVAR_047653175G → V. Corresponds to variant dbSNP:rs7081076Ensembl.1
Natural variantiVAR_035661195T → A in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_019654237T → A Has a protective role in both obesity and diabetes. 1 PublicationCorresponds to variant dbSNP:rs2281939Ensembl.1
Natural variantiVAR_047654485Y → C. Corresponds to variant dbSNP:rs35808802Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_05089526 – 57Missing in isoform 4, isoform 7, isoform 8, isoform 10 and isoform 12. 4 PublicationsAdd BLAST32
Alternative sequenceiVSP_050896101 – 109Missing in isoform 4, isoform 5, isoform 6 and isoform 7. 4 Publications9
Alternative sequenceiVSP_050898147 – 215Missing in isoform 3. 1 PublicationAdd BLAST69
Alternative sequenceiVSP_050899148 – 270Missing in isoform 4, isoform 6, isoform 8, isoform 9 and isoform 12. 5 PublicationsAdd BLAST123
Alternative sequenceiVSP_041193319 – 328Missing in isoform 12. Curated10
Alternative sequenceiVSP_050900408 – 453Missing in isoform 3, isoform 4, isoform 7, isoform 8, isoform 9, isoform 10, isoform 11 and isoform 12. 6 PublicationsAdd BLAST46
Alternative sequenceiVSP_050901431 – 451Missing in isoform 5. 3 PublicationsAdd BLAST21
Alternative sequenceiVSP_050902434 – 453DNPYT…SPKSE → TKSCSVMSPRLECSGTVIAH CSLKLLDSSNPPTSASQVAG TA in isoform 2. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_050903552 – 635Missing in isoform 4, isoform 7, isoform 9 and isoform 10. 4 PublicationsAdd BLAST84
Alternative sequenceiVSP_050905580 – 635Missing in isoform 6. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_050904580 – 601Missing in isoform 8 and isoform 12. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_050906602 – 635Missing in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_041194709K → KVDRKGGNAHMISSSSVHSR TFNTSNALGPVCKHKKPLSA AKACISEILPSKFKPRLSAP SALLQEQKSILLPSEKAQSC ENLCVSGSLNDSKRGLPLQV GGSIENLLMRSRRDYDSKSS STMSLQEYSTSGRRPCPLSR KAGMQFTMLYRDMHQINRSG LFLGSISSSSSVRDLASHFE KSSLALSRGELGPSQEGSEH IPKHTVSSRITAFEQLIQRS RSMPSLDLSGRLSKSPTPVL SRGSLTSARSAESLLESTKL HPKEMDGMNSSGVYASPTCS NMAHHALSFRGLVPSEPLST CSDDVDRCSNISTDSREGSG GSVHGDFPKHRLNKCKGTCP ASYTRFTTIRKHEQQQTSRQ PEWRLDARGDKSTLLRNIYL MSPLPFRLKKPLHHHPRQPS PGDSSGLLVGQKPDLPSQPH QDQPPSGGKPVVPTRLSSRH TMARLSRSSEPSQERPTALE DYPRAINNGNSVPYSDHSLD RNNNPQSELAPSRG in isoform 12. Curated1
Alternative sequenceiVSP_050907738 – 793Missing in isoform 4 and isoform 10. 2 PublicationsAdd BLAST56
Alternative sequenceiVSP_050908795 – 799MRPAR → KYDWA in isoform 7. 1 Publication5
Alternative sequenceiVSP_050909800 – 1292Missing in isoform 7. 1 PublicationAdd BLAST493
Alternative sequenceiVSP_050911955 – 1212Missing in isoform 4, isoform 5, isoform 6, isoform 8, isoform 9, isoform 10 and isoform 12. 7 PublicationsAdd BLAST258
Alternative sequenceiVSP_050910955 – 1117Missing in isoform 2. 1 PublicationAdd BLAST163
Alternative sequenceiVSP_050912956 – 975FSSHS…PHSRR → LSHHSLRAGPDLTESEKSYV in isoform 3. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_050913976 – 1213Missing in isoform 3. 1 PublicationAdd BLAST238
Alternative sequenceiVSP_0392101213Q → QLSHHSLRAGPDLTESEKSY V in isoform 11. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF136380 mRNA Translation: AAD27647.1
AF356525 mRNA Translation: AAK37563.1
AF356526 mRNA Translation: AAK37564.1
AF356527 mRNA Translation: AAK37565.1
AF330623 mRNA Translation: AAK57479.1
AF330624 mRNA Translation: AAK57480.1
AF136381 mRNA Translation: AAF22175.1
AJ489942 mRNA Translation: CAD34588.1
AM260536 mRNA Translation: CAJ97431.1
AB037717 mRNA Translation: BAA92534.1 Different initiation.
AL117472 mRNA Translation: CAB55947.1
AL158165 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW49999.1
CH471066 Genomic DNA Translation: EAW50007.1
BC042612 mRNA Translation: AAH42612.1
BC152463 mRNA Translation: AAI52464.1
U70668 mRNA Translation: AAB93496.1 Frameshift.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS31252.1 [Q9BX66-4]
CCDS31253.1 [Q9BX66-9]
CCDS31254.1 [Q9BX66-2]
CCDS31255.1 [Q9BX66-1]
CCDS31256.1 [Q9BX66-3]
CCDS73169.1 [Q9BX66-11]
CCDS7442.1 [Q9BX66-10]
CCDS76326.1 [Q9BX66-8]
CCDS76327.1 [Q9BX66-5]

Protein sequence database of the Protein Information Resource

More...
PIRi
T17257

NCBI Reference Sequences

More...
RefSeqi
NP_001030126.1, NM_001034954.1
NP_001030127.1, NM_001034955.1
NP_001030128.1, NM_001034956.1
NP_001030129.1, NM_001034957.1
NP_001277223.1, NM_001290294.1
NP_001277224.1, NM_001290295.1
NP_001277225.1, NM_001290296.1
NP_001277226.1, NM_001290297.1
NP_001277227.1, NM_001290298.1
NP_006425.2, NM_006434.2
NP_056200.1, NM_015385.3
NP_079267.1, NM_024991.2
XP_006717652.1, XM_006717589.1 [Q9BX66-5]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.38621

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000277982; ENSP00000277982; ENSG00000095637 [Q9BX66-2]
ENST00000306402; ENSP00000302556; ENSG00000095637 [Q9BX66-9]
ENST00000354106; ENSP00000277984; ENSG00000095637 [Q9BX66-5]
ENST00000361941; ENSP00000355136; ENSG00000095637 [Q9BX66-1]
ENST00000371227; ENSP00000360271; ENSG00000095637 [Q9BX66-11]
ENST00000371239; ENSP00000360283; ENSG00000095637 [Q9BX66-8]
ENST00000371241; ENSP00000360285; ENSG00000095637 [Q9BX66-4]
ENST00000371245; ENSP00000360291; ENSG00000095637 [Q9BX66-3]
ENST00000371246; ENSP00000360292; ENSG00000095637 [Q9BX66-2]
ENST00000371247; ENSP00000360293; ENSG00000095637 [Q9BX66-1]
ENST00000371249; ENSP00000360295; ENSG00000095637 [Q9BX66-10]
ENST00000607232; ENSP00000475901; ENSG00000095637 [Q9BX66-12]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10580

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10580

UCSC genome browser

More...
UCSCi
uc001kko.4 human [Q9BX66-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF136380 mRNA Translation: AAD27647.1
AF356525 mRNA Translation: AAK37563.1
AF356526 mRNA Translation: AAK37564.1
AF356527 mRNA Translation: AAK37565.1
AF330623 mRNA Translation: AAK57479.1
AF330624 mRNA Translation: AAK57480.1
AF136381 mRNA Translation: AAF22175.1
AJ489942 mRNA Translation: CAD34588.1
AM260536 mRNA Translation: CAJ97431.1
AB037717 mRNA Translation: BAA92534.1 Different initiation.
AL117472 mRNA Translation: CAB55947.1
AL158165 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW49999.1
CH471066 Genomic DNA Translation: EAW50007.1
BC042612 mRNA Translation: AAH42612.1
BC152463 mRNA Translation: AAI52464.1
U70668 mRNA Translation: AAB93496.1 Frameshift.
CCDSiCCDS31252.1 [Q9BX66-4]
CCDS31253.1 [Q9BX66-9]
CCDS31254.1 [Q9BX66-2]
CCDS31255.1 [Q9BX66-1]
CCDS31256.1 [Q9BX66-3]
CCDS73169.1 [Q9BX66-11]
CCDS7442.1 [Q9BX66-10]
CCDS76326.1 [Q9BX66-8]
CCDS76327.1 [Q9BX66-5]
PIRiT17257
RefSeqiNP_001030126.1, NM_001034954.1
NP_001030127.1, NM_001034955.1
NP_001030128.1, NM_001034956.1
NP_001030129.1, NM_001034957.1
NP_001277223.1, NM_001290294.1
NP_001277224.1, NM_001290295.1
NP_001277225.1, NM_001290296.1
NP_001277226.1, NM_001290297.1
NP_001277227.1, NM_001290298.1
NP_006425.2, NM_006434.2
NP_056200.1, NM_015385.3
NP_079267.1, NM_024991.2
XP_006717652.1, XM_006717589.1 [Q9BX66-5]
UniGeneiHs.38621

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DL3NMR-A796-850[»]
2ECZNMR-A870-926[»]
2LJ0NMR-A1228-1292[»]
2LJ1NMR-A1228-1291[»]
2MOXNMR-A791-930[»]
2O2WX-ray2.27A870-930[»]
2O31X-ray1.50A870-930[»]
2O9SX-ray0.83A870-930[»]
2O9VX-ray1.63A870-930[»]
4LN2X-ray1.00A866-930[»]
4LNPX-ray1.41A794-854[»]
ProteinModelPortaliQ9BX66
SMRiQ9BX66
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115831, 38 interactors
CORUMiQ9BX66
IntActiQ9BX66, 37 interactors
MINTiQ9BX66
STRINGi9606.ENSP00000355136

PTM databases

iPTMnetiQ9BX66
PhosphoSitePlusiQ9BX66

Polymorphism and mutation databases

BioMutaiSORBS1
DMDMi317373504

Proteomic databases

EPDiQ9BX66
MaxQBiQ9BX66
PaxDbiQ9BX66
PeptideAtlasiQ9BX66
PRIDEiQ9BX66
ProteomicsDBi79354
79355 [Q9BX66-10]
79356 [Q9BX66-11]
79357 [Q9BX66-12]
79358 [Q9BX66-2]
79359 [Q9BX66-3]
79360 [Q9BX66-4]
79361 [Q9BX66-5]
79362 [Q9BX66-6]
79363 [Q9BX66-7]
79364 [Q9BX66-8]
79365 [Q9BX66-9]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
10580
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000277982; ENSP00000277982; ENSG00000095637 [Q9BX66-2]
ENST00000306402; ENSP00000302556; ENSG00000095637 [Q9BX66-9]
ENST00000354106; ENSP00000277984; ENSG00000095637 [Q9BX66-5]
ENST00000361941; ENSP00000355136; ENSG00000095637 [Q9BX66-1]
ENST00000371227; ENSP00000360271; ENSG00000095637 [Q9BX66-11]
ENST00000371239; ENSP00000360283; ENSG00000095637 [Q9BX66-8]
ENST00000371241; ENSP00000360285; ENSG00000095637 [Q9BX66-4]
ENST00000371245; ENSP00000360291; ENSG00000095637 [Q9BX66-3]
ENST00000371246; ENSP00000360292; ENSG00000095637 [Q9BX66-2]
ENST00000371247; ENSP00000360293; ENSG00000095637 [Q9BX66-1]
ENST00000371249; ENSP00000360295; ENSG00000095637 [Q9BX66-10]
ENST00000607232; ENSP00000475901; ENSG00000095637 [Q9BX66-12]
GeneIDi10580
KEGGihsa:10580
UCSCiuc001kko.4 human [Q9BX66-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10580
DisGeNETi10580
EuPathDBiHostDB:ENSG00000095637.21

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SORBS1
HGNCiHGNC:14565 SORBS1
HPAiHPA027559
HPA043084
MIMi605264 gene
neXtProtiNX_Q9BX66
OpenTargetsiENSG00000095637
PharmGKBiPA37899

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4225 Eukaryota
ENOG410XNVJ LUCA
GeneTreeiENSGT00940000158658
HOVERGENiHBG053053
InParanoidiQ9BX66
KOiK06086
OMAiDYIDLPF
OrthoDBiEOG091G0172
PhylomeDBiQ9BX66
TreeFamiTF320680

Enzyme and pathway databases

ReactomeiR-HSA-445355 Smooth Muscle Contraction
SignaLinkiQ9BX66
SIGNORiQ9BX66

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SORBS1 human
EvolutionaryTraceiQ9BX66

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SORBS1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10580

Protein Ontology

More...
PROi
PR:Q9BX66

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000095637 Expressed in 227 organ(s), highest expression level in blood vessel layer
ExpressionAtlasiQ9BX66 baseline and differential
GenevisibleiQ9BX66 HS

Family and domain databases

CDDicd11919 SH3_Sorbs1_1, 1 hit
cd11922 SH3_Sorbs1_2, 1 hit
cd11916 SH3_Sorbs1_3, 1 hit
InterProiView protein in InterPro
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR003127 SoHo_dom
IPR028506 Sorbin_SH3
IPR035606 SORBS1_SH3
IPR035610 SORBS1_SH3_1
IPR035611 SORBS1_SH3_2
PANTHERiPTHR45043 PTHR45043, 2 hits
PfamiView protein in Pfam
PF00018 SH3_1, 1 hit
PF07653 SH3_2, 1 hit
PF14604 SH3_9, 1 hit
PF02208 Sorb, 1 hit
SMARTiView protein in SMART
SM00326 SH3, 3 hits
SM00459 Sorb, 1 hit
SUPFAMiSSF50044 SSF50044, 3 hits
PROSITEiView protein in PROSITE
PS50002 SH3, 3 hits
PS50831 SOHO, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSRBS1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BX66
Secondary accession number(s): A0AED4
, A6NEK3, A6NID8, A6NJS4, A7MD40, D3DR42, O43857, Q5T923, Q5T924, Q5T927, Q5T928, Q5T929, Q5T930, Q5T931, Q5T932, Q7LBE5, Q8IVK0, Q8IVQ4, Q96KF3, Q96KF4, Q9BX64, Q9BX65, Q9P2Q0, Q9UFT2, Q9UHN7, Q9Y338
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: January 11, 2011
Last modified: December 5, 2018
This is version 177 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again