Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 135 (16 Oct 2019)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Cell division cycle-associated protein 7

Gene

CDCA7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Participates in MYC-mediated cell transformation and apoptosis; induces anchorage-independent growth and clonogenicity in lymphoblastoid cells. Insufficient to induce tumorigenicity when overexpressed but contributes to MYC-mediated tumorigenesis. May play a role as transcriptional regulator.4 Publications

Miscellaneous

CDCA7 expression is correlated with MYC expression in lymphoblastoid, lymphoma and breast cancer cell lines.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis, Transcription, Transcription regulation

Enzyme and pathway databases

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q9BWT1

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cell division cycle-associated protein 7
Alternative name(s):
Protein JPO1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CDCA7
Synonyms:JPO1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14628 CDCA7

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609937 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BWT1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Immunodeficiency-centromeric instability-facial anomalies syndrome 3 (ICF3)1 Publication
The disease may be caused by mutations affecting the gene represented in this entry.
Disease descriptionA rare disorder characterized by a variable immunodeficiency resulting in recurrent infections, facial anomalies, and branching of chromosomes 1, 9, and 16. Other variable symptoms include growth retardation, failure to thrive, and psychomotor retardation. Laboratory studies show limited hypomethylation of DNA in a small fraction of the genome in some, but not all, patients.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_076578274R → C in ICF3. 1 PublicationCorresponds to variant dbSNP:rs879253738Ensembl.1
Natural variantiVAR_076579274R → H in ICF3. 1 PublicationCorresponds to variant dbSNP:rs370384522Ensembl.1
Natural variantiVAR_076580294G → V in ICF3; unknown pathological significance. 1 Publication1
Natural variantiVAR_076581304R → H in ICF3; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs772929976Ensembl.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi158R → A: Does not affect phosphorylation or interaction with YHWAE and YHWAZ. 1 Publication1
Mutagenesisi159P → A: Does not affect phosphorylation or interaction with YHWAE and YHWAZ. 1 Publication1
Mutagenesisi160R → A: Abolishes phosphorylation and interaction with YHWAE and YHWAZ. 1 Publication1
Mutagenesisi160R → E: Predominantly cytoplasmic. 1 Publication1
Mutagenesisi161R → A: Increased phosphorylation, binding to YHWAE and YHWAZ, and cytoplasmic expression. 1 Publication1
Mutagenesisi161R → E: Predominantly cytoplasmic. 1 Publication1
Mutagenesisi162R → A: Does not affect phosphorylation or interaction with YHWAE and YHWAZ. 1 Publication1
Mutagenesisi162R → E: Predominantly cytoplasmic. 1 Publication1
Mutagenesisi163T → A: Abolishes phosphorylation, interaction with YHWAE and YHWAZ, and cytoplasmic localization. 1 Publication1
Mutagenesisi164F → A: Abolishes phosphorylation and interaction with YHWAE and YHWAZ. 1 Publication1
Mutagenesisi165P → A: Abolishes phosphorylation, interaction with YHWAE and YHWAZ, and cytoplasmic localization. 1 Publication1
Mutagenesisi171R → E: Predominantly cytoplasmic. Completely cytoplasmic with no nuclear expression; when associated with E-176. 1 Publication1
Mutagenesisi176R → E: Predominantly cytoplasmic. Completely cytoplasmic with no nuclear expression; when associated with E-171. 1 Publication1
Mutagenesisi182R → E: No effect on subcellular location. 1 Publication1
Mutagenesisi184R → E: No effect on subcellular location. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
83879

MalaCards human disease database

More...
MalaCardsi
CDCA7
MIMi616910 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000144354

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
2268 ICF syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26280

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9BWT1

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CDCA7

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74733461

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002493101 – 371Cell division cycle-associated protein 7Add BLAST371

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei142PhosphoserineCombined sources1
Modified residuei163PhosphothreonineCombined sources1 Publication1
Modified residuei190PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki204Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation at Thr-163 promotes interaction with YWHAE and YWHAZ, dissociation from MYC and sequestration in the cytoplasm. In vitro, phosphorylated at Thr-163 by AKT.1 Publication

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9BWT1

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9BWT1

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9BWT1

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9BWT1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BWT1

PeptideAtlas

More...
PeptideAtlasi
Q9BWT1

PRoteomics IDEntifications database

More...
PRIDEi
Q9BWT1

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
4548
5247
79309 [Q9BWT1-1]
79310 [Q9BWT1-2]
79311 [Q9BWT1-3]
79312 [Q9BWT1-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BWT1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BWT1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous with higher level in thymus and small intestine. Overexpressed in a large number of tumors, in blood from patients with acute myelogenous leukemia (AML) and in chronic myelogenous leukemia (CML) blast crisis.2 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Activated by MYC and possibly E2F1.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000144354 Expressed in 160 organ(s), highest expression level in small intestine

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9BWT1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BWT1 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA005565

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MYC (via C-terminus), YWHAE and YWHAZ.

1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123792, 7 interactors

Protein interaction database and analysis system

More...
IntActi
Q9BWT1, 4 interactors

Molecular INTeraction database

More...
MINTi
Q9BWT1

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000306968

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni146 – 170Interaction with MYC1 PublicationAdd BLAST25
Regioni247 – 371Mediates transcriptional activityAdd BLAST125

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi160 – 176Nuclear localization signal1 PublicationAdd BLAST17

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi157 – 186Arg-richAdd BLAST30

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IFJD Eukaryota
ENOG410ZWEA LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155436

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231812

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BWT1

KEGG Orthology (KO)

More...
KOi
K23408

Identification of Orthologs from Complete Genome Data

More...
OMAi
DCWGIRG

Database of Orthologous Groups

More...
OrthoDBi
1462540at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BWT1

TreeFam database of animal gene trees

More...
TreeFami
TF101076

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR033576 CDCA7
IPR040221 CDCA7/CDA7L
IPR018866 Znf-4CXXC_R1

The PANTHER Classification System

More...
PANTHERi
PTHR31169 PTHR31169, 1 hit
PTHR31169:SF2 PTHR31169:SF2, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF10497 zf-4CXXC_R1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BWT1-1) [UniParc]FASTAAdd to basket
Also known as: isoform 2 variant

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDARRVPQKD LRVKKNLKKF RYVKLISMET SSSSDDSCDS FASDNFANTR
60 70 80 90 100
LQSVREGCRT RSQCRHSGPL RVAMKFPARS TRGATNKKAE SRQPSENSVT
110 120 130 140 150
DSNSDSEDES GMNFLEKRAL NIKQNKAMLA KLMSELESFP GSFRGRHPLP
160 170 180 190 200
GSDSQSRRPR RRTFPGVASR RNPERRARPL TRSRSRILGS LDALPMEEEE
210 220 230 240 250
EEDKYMLVRK RKTVDGYMNE DDLPRSRRSR SSVTLPHIIR PVEEITEEEL
260 270 280 290 300
ENVCSNSREK IYNRSLGSTC HQCRQKTIDT KTNCRNPDCW GVRGQFCGPC
310 320 330 340 350
LRNRYGEEVR DALLDPNWHC PPCRGICNCS FCRQRDGRCA TGVLVYLAKY
360 370
HGFGNVHAYL KSLKQEFEMQ A
Length:371
Mass (Da):42,573
Last modified:June 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i30A244E3057D9C43
GO
Isoform 2 (identifier: Q9BWT1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     49-49: T → TKPKFRSDIS...FSESEIQDGM

Show »
Length:450
Mass (Da):51,445
Checksum:iE0AE72184AEDAE39
GO
Isoform 3 (identifier: Q9BWT1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     267-316: Missing.

Note: No experimental confirmation available.
Show »
Length:321
Mass (Da):36,892
Checksum:i2F5A9FA6F14EA200
GO
Isoform 4 (identifier: Q9BWT1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     155-207: QSRRPRRRTF...EEEEEDKYML → VSTSSCLYTV...PPDRSLDDPP
     208-371: Missing.

Note: No experimental confirmation available.
Show »
Length:207
Mass (Da):23,340
Checksum:i77AF9BB96EFDDF0F
GO
Isoform 5 (identifier: Q9BWT1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     8-49: Missing.

Note: No experimental confirmation available.
Show »
Length:329
Mass (Da):37,786
Checksum:i50BB8953A4D83BAB
GO
Isoform 6 (identifier: Q9BWT1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     49-49: T → TKPRPDVTNELAGIFHADSDDESFCGFSESEIQDGM

Note: No experimental confirmation available.
Show »
Length:406
Mass (Da):46,400
Checksum:i236883B33F379260
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WBA7F8WBA7_HUMAN
Cell division cycle-associated prot...
CDCA7
56Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAH56357 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti152S → G in AAH15124 (PubMed:15489334).Curated1
Sequence conflicti320C → W in BAD97244 (Ref. 3) Curated1
Isoform 2 (identifier: Q9BWT1-2)
Sequence conflicti63N → S in BAB55245 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_076578274R → C in ICF3. 1 PublicationCorresponds to variant dbSNP:rs879253738Ensembl.1
Natural variantiVAR_076579274R → H in ICF3. 1 PublicationCorresponds to variant dbSNP:rs370384522Ensembl.1
Natural variantiVAR_076580294G → V in ICF3; unknown pathological significance. 1 Publication1
Natural variantiVAR_076581304R → H in ICF3; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs772929976Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0544078 – 49Missing in isoform 5. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_02039449T → TKPKFRSDISEELANVFYED SDNESFCGFSESEVQDVLDH CGFLQKPRPDVTNELAGIFH ADSDDESFCGFSESEIQDGM in isoform 2. 1 Publication1
Alternative sequenceiVSP_05440849T → TKPRPDVTNELAGIFHADSD DESFCGFSESEIQDGM in isoform 6. 1 Publication1
Alternative sequenceiVSP_020395155 – 207QSRRP…DKYML → VSTSSCLYTVVFWAHLRSIC VVFKNLISLFVWPSRQTKGT QRKPPDRSLDDPP in isoform 4. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_020396208 – 371Missing in isoform 4. 1 PublicationAdd BLAST164
Alternative sequenceiVSP_020397267 – 316Missing in isoform 3. 1 PublicationAdd BLAST50

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY029179 mRNA Translation: AAK31591.1
AK027628 mRNA Translation: BAB55245.1
AK027642 mRNA Translation: BAB55258.1
AK075134 mRNA Translation: BAC11425.1
AK297097 mRNA Translation: BAG59610.1
AK300949 mRNA Translation: BAG62578.1
AK223524 mRNA Translation: BAD97244.1
AL833728 mRNA Translation: CAH56253.1
AL834186 mRNA Translation: CAH56357.1 Frameshift.
AC092573 Genomic DNA Translation: AAX82003.1
BC015124 mRNA Translation: AAH15124.1
BC027966 mRNA Translation: AAH27966.1
BG354580 mRNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2252.1 [Q9BWT1-2]
CCDS2253.1 [Q9BWT1-1]

NCBI Reference Sequences

More...
RefSeqi
NP_114148.3, NM_031942.4 [Q9BWT1-2]
NP_665809.1, NM_145810.2 [Q9BWT1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000306721; ENSP00000306968; ENSG00000144354 [Q9BWT1-2]
ENST00000347703; ENSP00000272789; ENSG00000144354 [Q9BWT1-1]
ENST00000410019; ENSP00000386833; ENSG00000144354 [Q9BWT1-5]
ENST00000410101; ENSP00000386656; ENSG00000144354 [Q9BWT1-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
83879

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:83879

UCSC genome browser

More...
UCSCi
uc002uic.2 human [Q9BWT1-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY029179 mRNA Translation: AAK31591.1
AK027628 mRNA Translation: BAB55245.1
AK027642 mRNA Translation: BAB55258.1
AK075134 mRNA Translation: BAC11425.1
AK297097 mRNA Translation: BAG59610.1
AK300949 mRNA Translation: BAG62578.1
AK223524 mRNA Translation: BAD97244.1
AL833728 mRNA Translation: CAH56253.1
AL834186 mRNA Translation: CAH56357.1 Frameshift.
AC092573 Genomic DNA Translation: AAX82003.1
BC015124 mRNA Translation: AAH15124.1
BC027966 mRNA Translation: AAH27966.1
BG354580 mRNA No translation available.
CCDSiCCDS2252.1 [Q9BWT1-2]
CCDS2253.1 [Q9BWT1-1]
RefSeqiNP_114148.3, NM_031942.4 [Q9BWT1-2]
NP_665809.1, NM_145810.2 [Q9BWT1-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi123792, 7 interactors
IntActiQ9BWT1, 4 interactors
MINTiQ9BWT1
STRINGi9606.ENSP00000306968

PTM databases

iPTMnetiQ9BWT1
PhosphoSitePlusiQ9BWT1

Polymorphism and mutation databases

BioMutaiCDCA7
DMDMi74733461

Proteomic databases

EPDiQ9BWT1
jPOSTiQ9BWT1
MassIVEiQ9BWT1
MaxQBiQ9BWT1
PaxDbiQ9BWT1
PeptideAtlasiQ9BWT1
PRIDEiQ9BWT1
ProteomicsDBi4548
5247
79309 [Q9BWT1-1]
79310 [Q9BWT1-2]
79311 [Q9BWT1-3]
79312 [Q9BWT1-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
83879

Genome annotation databases

EnsembliENST00000306721; ENSP00000306968; ENSG00000144354 [Q9BWT1-2]
ENST00000347703; ENSP00000272789; ENSG00000144354 [Q9BWT1-1]
ENST00000410019; ENSP00000386833; ENSG00000144354 [Q9BWT1-5]
ENST00000410101; ENSP00000386656; ENSG00000144354 [Q9BWT1-6]
GeneIDi83879
KEGGihsa:83879
UCSCiuc002uic.2 human [Q9BWT1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
83879
DisGeNETi83879

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CDCA7
HGNCiHGNC:14628 CDCA7
HPAiHPA005565
MalaCardsiCDCA7
MIMi609937 gene
616910 phenotype
neXtProtiNX_Q9BWT1
OpenTargetsiENSG00000144354
Orphaneti2268 ICF syndrome
PharmGKBiPA26280

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IFJD Eukaryota
ENOG410ZWEA LUCA
GeneTreeiENSGT00940000155436
HOGENOMiHOG000231812
InParanoidiQ9BWT1
KOiK23408
OMAiDCWGIRG
OrthoDBi1462540at2759
PhylomeDBiQ9BWT1
TreeFamiTF101076

Enzyme and pathway databases

SIGNORiQ9BWT1

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CDCA7 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
CDCA7

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
83879
PharosiQ9BWT1

Protein Ontology

More...
PROi
PR:Q9BWT1

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000144354 Expressed in 160 organ(s), highest expression level in small intestine
ExpressionAtlasiQ9BWT1 baseline and differential
GenevisibleiQ9BWT1 HS

Family and domain databases

InterProiView protein in InterPro
IPR033576 CDCA7
IPR040221 CDCA7/CDA7L
IPR018866 Znf-4CXXC_R1
PANTHERiPTHR31169 PTHR31169, 1 hit
PTHR31169:SF2 PTHR31169:SF2, 1 hit
PfamiView protein in Pfam
PF10497 zf-4CXXC_R1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCDCA7_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BWT1
Secondary accession number(s): B4DLP8
, B4DV66, Q53EW5, Q580W9, Q658K4, Q658N4, Q8NBY9, Q96BV8, Q96SP5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 5, 2006
Last sequence update: June 1, 2001
Last modified: October 16, 2019
This is version 135 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again