Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 165 (12 Aug 2020)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Collectin-11

Gene

COLEC11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Lectin that plays a role in innate immunity, apoptosis and embryogenesis (PubMed:23954398, PubMed:25912189, PubMed:21258343). Calcium-dependent lectin that binds self and non-self glycoproteins presenting high mannose oligosaccharides with at least one terminal alpha-1,2-linked mannose epitope (PubMed:25912189). Primarily recognizes the terminal disaccharide of the glycan (PubMed:25912189). Also recognizes a subset of fucosylated glycans and lipopolysaccharides (PubMed:17179669, PubMed:25912189). Plays a role in innate immunity through its ability to bind non-self sugars presented by microorganisms and to activate the complement through the recruitment of MAPS1 (PubMed:20956340, PubMed:25912189). Also plays a role in apoptosis through its ability to bind in a calcium-independent manner the DNA present at the surface of apoptotic cells and to activate the complement in response to this binding (Probable). Finally, plays a role in development, probably serving as a guidance cue during the migration of neural crest cells and other cell types during embryogenesis (PubMed:21258343, PubMed:28301481).2 Publications6 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei200CarbohydrateCombined sources1 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi207Calcium 1Combined sources1 Publication1
Metal bindingi211Calcium 1Combined sources1 Publication1
Metal bindingi211Calcium 3Combined sources1 Publication1
Metal bindingi232Calcium 2Combined sources1 Publication1
Metal bindingi234Calcium 2Combined sources1 Publication1
Metal bindingi235Calcium 1Combined sources1 Publication1
Metal bindingi238Calcium 3; via carbonyl oxygenCombined sources1 Publication1
Metal bindingi240Calcium 1; via carbonyl oxygenCombined sources1 Publication1
Metal bindingi240Calcium 2Combined sources1 Publication1
Binding sitei240CarbohydrateCombined sources1 Publication1
Metal bindingi241Calcium 1Combined sources1 Publication1
Metal bindingi241Calcium 3Combined sources1 Publication1
Binding sitei244CarbohydrateCombined sources1 Publication1
Metal bindingi252Calcium 2Combined sources1 Publication1
Metal bindingi253Calcium 2Combined sources1 Publication1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processImmunity, Innate immunity
LigandCalcium, Lectin, Mannose-binding, Metal-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q9BWP8

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-166662, Lectin pathway of complement activation
R-HSA-166663, Initial triggering of complement
R-HSA-3000480, Scavenging by Class A Receptors

Protein family/group databases

UniLectin database of carbohydrate-binding proteins

More...
UniLectini
Q9BWP8

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Collectin-11
Alternative name(s):
Collectin kidney protein 1
Short name:
CL-K1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:COLEC11
ORF Names:UNQ596/PRO1182
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000118004.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17213, COLEC11

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
612502, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BWP8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

3MC syndrome 2 (3MC2)3 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of 3MC syndrome, an autosomal recessive disorder characterized by facial dysmorphism, craniosynostosis, learning disability, and genital, limb and vesicorenal anomalies. Facial features include hypertelorism, blepharophimosis, blepharoptosis and highly arched eyebrows, cleft lip and/or palate. The term 3MC syndrome includes Carnevale, Mingarelli, Malpuech, and Michels syndromes.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_078813166A → T in 3MC2; unknown pathological significance. 1 Publication1
Natural variantiVAR_065901169S → P in 3MC2; no effect on homotrimerization; loss of calcium-binding; loss of carbohydrate-binding probably due to the inability to bind calcium; not secreted probably due to degradation early after biosynthesis. 2 PublicationsCorresponds to variant dbSNP:rs387907075EnsemblClinVar.1
Natural variantiVAR_065902204G → S in 3MC2; no effect on homotrimerization; loss of calcium-binding; loss of carbohydrate-binding probably due to the inability to bind calcium; not secreted probably due to degradation early after biosynthesis. 2 PublicationsCorresponds to variant dbSNP:rs387907076EnsemblClinVar.1
Natural variantiVAR_065903217Missing in 3MC2; no effect on homotrimerization; loss of calcium-binding; loss of carbohydrate-binding probably due to the inability to bind calcium; not secreted probably due to degradation early after biosynthesis. 2 Publications1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
78989

MalaCards human disease database

More...
MalaCardsi
COLEC11
MIMi265050, phenotype

Open Targets

More...
OpenTargetsi
ENSG00000118004

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
293843, 3MC syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26737

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q9BWP8, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
COLEC11

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74733453

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 25Sequence analysisAdd BLAST25
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000031504426 – 271Collectin-11Add BLAST246

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi170 ↔ 264PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi242 ↔ 256PROSITE-ProRule annotationCombined sources1 Publication

Keywords - PTMi

Disulfide bond

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q9BWP8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BWP8

PeptideAtlas

More...
PeptideAtlasi
Q9BWP8

PRoteomics IDEntifications database

More...
PRIDEi
Q9BWP8

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
79295 [Q9BWP8-1]
79296 [Q9BWP8-2]
79297 [Q9BWP8-3]
79298 [Q9BWP8-4]
79299 [Q9BWP8-5]
79300 [Q9BWP8-6]
79301 [Q9BWP8-7]
79302 [Q9BWP8-8]
79303 [Q9BWP8-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BWP8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BWP8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous (PubMed:17179669). Detected in adrenal gland, kidney, liver, ovaries and testis (at protein level) (PubMed:20956340).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000118004, Expressed in liver and 143 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9BWP8, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BWP8, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000118004, Tissue enhanced (gallbladder, liver)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotrimer; disulfide-linked (PubMed:20956340, PubMed:25912189).

Interacts with MASP1; probably triggers the lectin pathway of complement (PubMed:20956340).

2 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
122460, 13 interactors

Protein interaction database and analysis system

More...
IntActi
Q9BWP8, 8 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000411770

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q9BWP8, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1271
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9BWP8

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini65 – 112Collagen-likeAdd BLAST48
Domaini149 – 265C-type lectinPROSITE-ProRule annotationAdd BLAST117

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni252 – 254Carbohydrate bindingCombined sources1 Publication3

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili114 – 148Sequence analysisAdd BLAST35

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the COLEC10/COLEC11 family.Curated

Keywords - Domaini

Coiled coil, Collagen, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4297, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159468

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_049894_3_2_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BWP8

KEGG Orthology (KO)

More...
KOi
K10066

Identification of Orthologs from Complete Genome Data

More...
OMAi
MGRHGKI

Database of Orthologous Groups

More...
OrthoDBi
1105722at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BWP8

TreeFam database of animal gene trees

More...
TreeFami
TF330481

Family and domain databases

Conserved Domains Database

More...
CDDi
cd03591, CLECT_collectin_like, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.10.100.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001304, C-type_lectin-like
IPR016186, C-type_lectin-like/link_sf
IPR018378, C-type_lectin_CS
IPR008160, Collagen
IPR033990, Collectin_CTLD
IPR016187, CTDL_fold

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01391, Collagen, 2 hits
PF00059, Lectin_C, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00034, CLECT, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56436, SSF56436, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00615, C_TYPE_LECTIN_1, 1 hit
PS50041, C_TYPE_LECTIN_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (10+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 10 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 10 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BWP8-1) [UniParc]FASTAAdd to basket
Also known as: CL-K1-I

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRGNLALVGV LISLAFLSLL PSGHPQPAGD DACSVQILVP GLKGDAGEKG
60 70 80 90 100
DKGAPGRPGR VGPTGEKGDM GDKGQKGSVG RHGKIGPIGS KGEKGDSGDI
110 120 130 140 150
GPPGPNGEPG LPCECSQLRK AIGEMDNQVS QLTSELKFIK NAVAGVRETE
160 170 180 190 200
SKIYLLVKEE KRYADAQLSC QGRGGTLSMP KDEAANGLMA AYLAQAGLAR
210 220 230 240 250
VFIGINDLEK EGAFVYSDHS PMRTFNKWRS GEPNNAYDEE DCVEMVASGG
260 270
WNDVACHTTM YFMCEFDKEN M
Length:271
Mass (Da):28,665
Last modified:June 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA14A248CE41DB340
GO
Isoform 2 (identifier: Q9BWP8-2) [UniParc]FASTAAdd to basket
Also known as: CL-K1-Ia

The sequence of this isoform differs from the canonical sequence as follows:
     43-66: Missing.

Show »
Length:247
Mass (Da):26,390
Checksum:i3883FC667BD5F2F3
GO
Isoform 3 (identifier: Q9BWP8-3) [UniParc]FASTAAdd to basket
Also known as: CL-K1-Ib

The sequence of this isoform differs from the canonical sequence as follows:
     67-90: Missing.

Show »
Length:247
Mass (Da):26,317
Checksum:i11BF243DE39E8C1B
GO
Isoform 4 (identifier: Q9BWP8-4) [UniParc]FASTAAdd to basket
Also known as: CL-K1-II

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MRGNLALVGVLISLAFLSLLPSGHPQPAGDDACSVQILVPGLK → MWWVPPSPYGCLPCALP

Show »
Length:245
Mass (Da):26,213
Checksum:iEE07AA560B7E5432
GO
Isoform 5 (identifier: Q9BWP8-5) [UniParc]FASTAAdd to basket
Also known as: CL-K1-Ic

The sequence of this isoform differs from the canonical sequence as follows:
     43-90: Missing.

Show »
Length:223
Mass (Da):24,041
Checksum:i0701E755B9FCBE3F
GO
Isoform 6 (identifier: Q9BWP8-6) [UniParc]FASTAAdd to basket
Also known as: CL-K1-IIa

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: Missing.
     51-67: DKGAPGRPGRVGPTGEK → MWWVPPSPYGCLPCALP

Show »
Length:221
Mass (Da):23,938
Checksum:i06EC9291E8A41E01
GO
Isoform 7 (identifier: Q9BWP8-7) [UniParc]FASTAAdd to basket
Also known as: CL-K1-IIb

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MRGNLALVGVLISLAFLSLLPSGHPQPAGDDACSVQILVPGLK → MWWVPPSPYGCLPCALP
     67-90: Missing.

Show »
Length:221
Mass (Da):23,865
Checksum:i2FD04ACA70EF60E9
GO
Isoform 8 (identifier: Q9BWP8-8) [UniParc]FASTAAdd to basket
Also known as: CL-K1-IIc

The sequence of this isoform differs from the canonical sequence as follows:
     1-74: Missing.
     75-91: QKGSVGRHGKIGPIGSK → MWWVPPSPYGCLPCALP

Show »
Length:197
Mass (Da):21,589
Checksum:i6B47DE5D4E9D1CB6
GO
Isoform 9 (identifier: Q9BWP8-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: MRGNLALVGV...PGRVGPTGEK → MTPALCRSSS...TSSFVEMGSQ

Show »
Length:268
Mass (Da):29,006
Checksum:i30C30CC8258AA9B7
GO
Isoform 10 (identifier: Q9BWP8-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKKQRGVGVLPALRM

Show »
Length:285
Mass (Da):30,200
Checksum:i54B2EB71B4AAFE79
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JWT5C9JWT5_HUMAN
Collectin-11
COLEC11
123Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WB29F8WB29_HUMAN
Collectin-11
COLEC11
116Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti178S → T in CAI56781 (PubMed:17974005).Curated1
Sequence conflicti231G → D in BAG64772 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_078813166A → T in 3MC2; unknown pathological significance. 1 Publication1
Natural variantiVAR_065901169S → P in 3MC2; no effect on homotrimerization; loss of calcium-binding; loss of carbohydrate-binding probably due to the inability to bind calcium; not secreted probably due to degradation early after biosynthesis. 2 PublicationsCorresponds to variant dbSNP:rs387907075EnsemblClinVar.1
Natural variantiVAR_065902204G → S in 3MC2; no effect on homotrimerization; loss of calcium-binding; loss of carbohydrate-binding probably due to the inability to bind calcium; not secreted probably due to degradation early after biosynthesis. 2 PublicationsCorresponds to variant dbSNP:rs387907076EnsemblClinVar.1
Natural variantiVAR_065903217Missing in 3MC2; no effect on homotrimerization; loss of calcium-binding; loss of carbohydrate-binding probably due to the inability to bind calcium; not secreted probably due to degradation early after biosynthesis. 2 Publications1
Natural variantiVAR_038143219H → R1 PublicationCorresponds to variant dbSNP:rs7567833Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0304631 – 74Missing in isoform 8. 1 PublicationAdd BLAST74
Alternative sequenceiVSP_0304641 – 67MRGNL…PTGEK → MTPALCRSSSLASKGMRERR ETKAPPDGLEESAPREKKQS QPVVTASDISKRKCTSSFVE MGSQ in isoform 9. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_0304651 – 50Missing in isoform 6. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_0304661 – 43MRGNL…VPGLK → MWWVPPSPYGCLPCALP in isoform 4 and isoform 7. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_0455321M → MKKQRGVGVLPALRM in isoform 10. 1 Publication1
Alternative sequenceiVSP_03046743 – 90Missing in isoform 5. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_03046843 – 66Missing in isoform 2. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_03046951 – 67DKGAP…PTGEK → MWWVPPSPYGCLPCALP in isoform 6. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_03047067 – 90Missing in isoform 3 and isoform 7. 2 PublicationsAdd BLAST24
Alternative sequenceiVSP_03047175 – 91QKGSV…PIGSK → MWWVPPSPYGCLPCALP in isoform 8. 1 PublicationAdd BLAST17

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB119525 mRNA Translation: BAF43301.1
AB119650 mRNA Translation: BAF43302.1
AB119651 mRNA Translation: BAF43303.1
AB119652 mRNA Translation: BAF43304.1
AB119684 mRNA Translation: BAF79604.1
AB119685 mRNA Translation: BAF79605.1
AB119686 mRNA Translation: BAF79606.1
AB119687 mRNA Translation: BAF79607.1
AY358439 mRNA Translation: AAQ88805.1
AK303824 mRNA Translation: BAG64772.1
AK313840 mRNA Translation: BAG36572.1
AC010907 Genomic DNA Translation: AAY24235.1
CH471053 Genomic DNA Translation: EAX01053.1
CH471053 Genomic DNA Translation: EAX01054.1
CH471053 Genomic DNA Translation: EAX01055.1
BC000078 mRNA Translation: AAH00078.1
BC009951 mRNA Translation: AAH09951.1
CR936641 mRNA Translation: CAI56781.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1649.1 [Q9BWP8-1]
CCDS1650.1 [Q9BWP8-9]
CCDS58689.1 [Q9BWP8-10]
CCDS58690.1 [Q9BWP8-3]
CCDS58691.1 [Q9BWP8-4]
CCDS58692.1 [Q9BWP8-7]
CCDS58693.1 [Q9BWP8-6]
CCDS58694.1 [Q9BWP8-8]

NCBI Reference Sequences

More...
RefSeqi
NP_001242911.1, NM_001255982.1 [Q9BWP8-2]
NP_001242912.1, NM_001255983.1 [Q9BWP8-3]
NP_001242913.1, NM_001255984.1 [Q9BWP8-5]
NP_001242914.1, NM_001255985.1 [Q9BWP8-10]
NP_001242915.1, NM_001255986.1 [Q9BWP8-4]
NP_001242916.1, NM_001255987.1 [Q9BWP8-6]
NP_001242917.1, NM_001255988.1 [Q9BWP8-7]
NP_001242918.1, NM_001255989.1 [Q9BWP8-8]
NP_076932.1, NM_024027.4 [Q9BWP8-1]
NP_954705.1, NM_199235.2 [Q9BWP8-9]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000236693; ENSP00000236693; ENSG00000118004 [Q9BWP8-9]
ENST00000349077; ENSP00000339168; ENSG00000118004 [Q9BWP8-1]
ENST00000382062; ENSP00000371494; ENSG00000118004 [Q9BWP8-3]
ENST00000402794; ENSP00000384882; ENSG00000118004 [Q9BWP8-6]
ENST00000402922; ENSP00000385653; ENSG00000118004 [Q9BWP8-7]
ENST00000403096; ENSP00000385130; ENSG00000118004 [Q9BWP8-4]
ENST00000404205; ENSP00000385827; ENSG00000118004 [Q9BWP8-8]
ENST00000418971; ENSP00000411770; ENSG00000118004 [Q9BWP8-10]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
78989

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:78989

UCSC genome browser

More...
UCSCi
uc002qxz.5, human [Q9BWP8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Functional Glycomics Gateway - Glycan Binding

Collectin K1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB119525 mRNA Translation: BAF43301.1
AB119650 mRNA Translation: BAF43302.1
AB119651 mRNA Translation: BAF43303.1
AB119652 mRNA Translation: BAF43304.1
AB119684 mRNA Translation: BAF79604.1
AB119685 mRNA Translation: BAF79605.1
AB119686 mRNA Translation: BAF79606.1
AB119687 mRNA Translation: BAF79607.1
AY358439 mRNA Translation: AAQ88805.1
AK303824 mRNA Translation: BAG64772.1
AK313840 mRNA Translation: BAG36572.1
AC010907 Genomic DNA Translation: AAY24235.1
CH471053 Genomic DNA Translation: EAX01053.1
CH471053 Genomic DNA Translation: EAX01054.1
CH471053 Genomic DNA Translation: EAX01055.1
BC000078 mRNA Translation: AAH00078.1
BC009951 mRNA Translation: AAH09951.1
CR936641 mRNA Translation: CAI56781.1
CCDSiCCDS1649.1 [Q9BWP8-1]
CCDS1650.1 [Q9BWP8-9]
CCDS58689.1 [Q9BWP8-10]
CCDS58690.1 [Q9BWP8-3]
CCDS58691.1 [Q9BWP8-4]
CCDS58692.1 [Q9BWP8-7]
CCDS58693.1 [Q9BWP8-6]
CCDS58694.1 [Q9BWP8-8]
RefSeqiNP_001242911.1, NM_001255982.1 [Q9BWP8-2]
NP_001242912.1, NM_001255983.1 [Q9BWP8-3]
NP_001242913.1, NM_001255984.1 [Q9BWP8-5]
NP_001242914.1, NM_001255985.1 [Q9BWP8-10]
NP_001242915.1, NM_001255986.1 [Q9BWP8-4]
NP_001242916.1, NM_001255987.1 [Q9BWP8-6]
NP_001242917.1, NM_001255988.1 [Q9BWP8-7]
NP_001242918.1, NM_001255989.1 [Q9BWP8-8]
NP_076932.1, NM_024027.4 [Q9BWP8-1]
NP_954705.1, NM_199235.2 [Q9BWP8-9]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4YLIX-ray2.45A/B/C/D/E/F116-270[»]
4YMDX-ray2.87A/B/C/D/E/F116-270[»]
SMRiQ9BWP8
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi122460, 13 interactors
IntActiQ9BWP8, 8 interactors
STRINGi9606.ENSP00000411770

Protein family/group databases

UniLectiniQ9BWP8

PTM databases

iPTMnetiQ9BWP8
PhosphoSitePlusiQ9BWP8

Polymorphism and mutation databases

BioMutaiCOLEC11
DMDMi74733453

Proteomic databases

MassIVEiQ9BWP8
PaxDbiQ9BWP8
PeptideAtlasiQ9BWP8
PRIDEiQ9BWP8
ProteomicsDBi79295 [Q9BWP8-1]
79296 [Q9BWP8-2]
79297 [Q9BWP8-3]
79298 [Q9BWP8-4]
79299 [Q9BWP8-5]
79300 [Q9BWP8-6]
79301 [Q9BWP8-7]
79302 [Q9BWP8-8]
79303 [Q9BWP8-9]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
26364, 156 antibodies

The DNASU plasmid repository

More...
DNASUi
78989

Genome annotation databases

EnsembliENST00000236693; ENSP00000236693; ENSG00000118004 [Q9BWP8-9]
ENST00000349077; ENSP00000339168; ENSG00000118004 [Q9BWP8-1]
ENST00000382062; ENSP00000371494; ENSG00000118004 [Q9BWP8-3]
ENST00000402794; ENSP00000384882; ENSG00000118004 [Q9BWP8-6]
ENST00000402922; ENSP00000385653; ENSG00000118004 [Q9BWP8-7]
ENST00000403096; ENSP00000385130; ENSG00000118004 [Q9BWP8-4]
ENST00000404205; ENSP00000385827; ENSG00000118004 [Q9BWP8-8]
ENST00000418971; ENSP00000411770; ENSG00000118004 [Q9BWP8-10]
GeneIDi78989
KEGGihsa:78989
UCSCiuc002qxz.5, human [Q9BWP8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
78989
DisGeNETi78989
EuPathDBiHostDB:ENSG00000118004.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
COLEC11
HGNCiHGNC:17213, COLEC11
HPAiENSG00000118004, Tissue enhanced (gallbladder, liver)
MalaCardsiCOLEC11
MIMi265050, phenotype
612502, gene
neXtProtiNX_Q9BWP8
OpenTargetsiENSG00000118004
Orphaneti293843, 3MC syndrome
PharmGKBiPA26737

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4297, Eukaryota
GeneTreeiENSGT00940000159468
HOGENOMiCLU_049894_3_2_1
InParanoidiQ9BWP8
KOiK10066
OMAiMGRHGKI
OrthoDBi1105722at2759
PhylomeDBiQ9BWP8
TreeFamiTF330481

Enzyme and pathway databases

PathwayCommonsiQ9BWP8
ReactomeiR-HSA-166662, Lectin pathway of complement activation
R-HSA-166663, Initial triggering of complement
R-HSA-3000480, Scavenging by Class A Receptors

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
78989, 5 hits in 869 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
COLEC11, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
78989
PharosiQ9BWP8, Tbio

Protein Ontology

More...
PROi
PR:Q9BWP8
RNActiQ9BWP8, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000118004, Expressed in liver and 143 other tissues
ExpressionAtlasiQ9BWP8, baseline and differential
GenevisibleiQ9BWP8, HS

Family and domain databases

CDDicd03591, CLECT_collectin_like, 1 hit
Gene3Di3.10.100.10, 1 hit
InterProiView protein in InterPro
IPR001304, C-type_lectin-like
IPR016186, C-type_lectin-like/link_sf
IPR018378, C-type_lectin_CS
IPR008160, Collagen
IPR033990, Collectin_CTLD
IPR016187, CTDL_fold
PfamiView protein in Pfam
PF01391, Collagen, 2 hits
PF00059, Lectin_C, 1 hit
SMARTiView protein in SMART
SM00034, CLECT, 1 hit
SUPFAMiSSF56436, SSF56436, 1 hit
PROSITEiView protein in PROSITE
PS00615, C_TYPE_LECTIN_1, 1 hit
PS50041, C_TYPE_LECTIN_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCOL11_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BWP8
Secondary accession number(s): A1IGE4
, A1IGE5, A1IGE6, A7VJJ2, A7VJJ3, A7VJJ4, A7VJJ5, B2R9M5, B4E1G0, J3KQY9, Q5CZ85, Q7Z6N1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: June 1, 2001
Last modified: August 12, 2020
This is version 165 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
  5. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again