Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 143 (13 Feb 2019)
Sequence version 1 (01 Jun 2001)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Replication initiator 1

Gene

REPIN1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Sequence-specific double-stranded DNA-binding protein required for initiation of chromosomal DNA replication. Binds on 5'-ATT-3' reiterated sequences downstream of the origin of bidirectional replication (OBR) and a second, homologous ATT sequence of opposite orientation situated within the OBR zone. Facilitates DNA bending.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri57 – 79C2H2-type 1; atypicalPROSITE-ProRule annotationAdd BLAST23
Zinc fingeri85 – 107C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri116 – 138C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri145 – 168C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri177 – 199C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri236 – 258C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri264 – 286C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri292 – 314C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri375 – 397C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri403 – 425C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri431 – 453C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri459 – 481C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri487 – 509C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri515 – 537C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri543 – 565C2H2-type 15PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • DNA binding Source: ProtInc
  • metal ion binding Source: UniProtKB-KW
  • RNA binding Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processDNA replication
LigandMetal-binding, Zinc

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q9BWE0

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Replication initiator 1
Alternative name(s):
60 kDa origin-specific DNA-binding protein
60 kDa replication initiation region protein
ATT-binding protein
DHFR oribeta-binding protein RIP60
Zinc finger protein 464
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:REPIN1
Synonyms:RIP60, ZNF464
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000214022.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17922 REPIN1

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q9BWE0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000214022

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134933473

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
REPIN1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74761300

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002749121 – 567Replication initiator 1Add BLAST567

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei27PhosphoserineCombined sources1
Modified residuei30PhosphothreonineCombined sources1
Modified residuei33N6-acetyllysineCombined sources1
Modified residuei276N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q9BWE0

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q9BWE0

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q9BWE0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q9BWE0

PeptideAtlas

More...
PeptideAtlasi
Q9BWE0

PRoteomics IDEntifications database

More...
PRIDEi
Q9BWE0

ProteomicsDB human proteome resource

More...
ProteomicsDBi
79270

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q9BWE0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q9BWE0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000214022 Expressed in 230 organ(s), highest expression level in skeletal muscle tissue

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q9BWE0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q9BWE0 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA036022

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimers and homomultimers. Found in a complex with RIP60 and RIP100.2 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
118927, 40 interactors

Protein interaction database and analysis system

More...
IntActi
Q9BWE0, 11 interactors

Molecular INTeraction database

More...
MINTi
Q9BWE0

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000417291

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q9BWE0

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q9BWE0

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi325 – 372Pro-richAdd BLAST48

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri57 – 79C2H2-type 1; atypicalPROSITE-ProRule annotationAdd BLAST23
Zinc fingeri85 – 107C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri116 – 138C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri145 – 168C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri177 – 199C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri236 – 258C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri264 – 286C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri292 – 314C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri375 – 397C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri403 – 425C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri431 – 453C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri459 – 481C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri487 – 509C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri515 – 537C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri543 – 565C2H2-type 15PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1721 Eukaryota
COG5048 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162588

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000234617

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG018163

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q9BWE0

Identification of Orthologs from Complete Genome Data

More...
OMAi
ECACCGK

Database of Orthologous Groups

More...
OrthoDBi
1318335at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q9BWE0

TreeFam database of animal gene trees

More...
TreeFami
TF326846

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR039705 REPIN1
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

The PANTHER Classification System

More...
PANTHERi
PTHR24406 PTHR24406, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00096 zf-C2H2, 10 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00355 ZnF_C2H2, 15 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57667 SSF57667, 9 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 14 hits
PS50157 ZINC_FINGER_C2H2_2, 14 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q9BWE0-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLERRCRGPL AMGLAQPRLL SGPSQESPQT LGKESRGLRQ QGTSVAQSGA
60 70 80 90 100
QAPGRAHRCA HCRRHFPGWV ALWLHTRRCQ ARLPLPCPEC GRRFRHAPFL
110 120 130 140 150
ALHRQVHAAA TPDLGFACHL CGQSFRGWVA LVLHLRAHSA AKRPIACPKC
160 170 180 190 200
ERRFWRRKQL RAHLRRCHPP APEARPFICG NCGRSFAQWD QLVAHKRVHV
210 220 230 240 250
AEALEEAAAK ALGPRPRGRP AVTAPRPGGD AVDRPFQCAC CGKRFRHKPN
260 270 280 290 300
LIAHRRVHTG ERPHQCPECG KRFTNKPYLT SHRRIHTGEK PYPCKECGRR
310 320 330 340 350
FRHKPNLLSH SKIHKRSEGS AQAAPGPGSP QLPAGPQESA AEPTPAVPLK
360 370 380 390 400
PAQEPPPGAP PEHPQDPIEA PPSLYSCDDC GRSFRLERFL RAHQRQHTGE
410 420 430 440 450
RPFTCAECGK NFGKKTHLVA HSRVHSGERP FACEECGRRF SQGSHLAAHR
460 470 480 490 500
RDHAPDRPFV CPDCGKAFRH KPYLAAHRRI HTGEKPYVCP DCGKAFSQKS
510 520 530 540 550
NLVSHRRIHT GERPYACPDC DRSFSQKSNL ITHRKSHIRD GAFCCAICGQ
560
TFDDEERLLA HQKKHDV
Length:567
Mass (Da):63,575
Last modified:June 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i00D43EC28E176237
GO
Isoform 2 (identifier: Q9BWE0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGIGVSLLLQFSLTPGGYRSVGRSRRCSRGSIPRNIPKRSWKKPHPQLCSLQAEEEPM

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:624
Mass (Da):69,920
Checksum:i552927277BD07931
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JZE3C9JZE3_HUMAN
Replication initiator 1
REPIN1
366Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JYJ8C9JYJ8_HUMAN
Replication initiator 1
REPIN1
393Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EVL6E7EVL6_HUMAN
Replication initiator 1
REPIN1
146Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J7L2C9J7L2_HUMAN
Replication initiator 1
REPIN1
87Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J590C9J590_HUMAN
Replication initiator 1
REPIN1
136Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J0L4C9J0L4_HUMAN
Replication initiator 1
REPIN1
55Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J7D4C9J7D4_HUMAN
Replication initiator 1
REPIN1
47Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RK52E5RK52_HUMAN
Replication initiator 1
REPIN1
136Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH00363 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAS00386 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAB53100 differs from that shown. Reason: Frameshift at position 8.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti136R → L in AAF26712 (PubMed:10606657).Curated1
Sequence conflicti143R → Q in AAF26712 (PubMed:10606657).Curated1
Sequence conflicti165R → Q in CAB53100 (Ref. 2) Curated1
Sequence conflicti173E → A in CAB53100 (Ref. 2) Curated1
Sequence conflicti211A → V in CAB53100 (Ref. 2) Curated1
Sequence conflicti216P → S in CAB53100 (Ref. 2) Curated1
Sequence conflicti396 – 397QH → HD in AAF26712 (PubMed:10606657).Curated2
Sequence conflicti423R → P in AAF26712 (PubMed:10606657).Curated1
Sequence conflicti451R → P in AAF26712 (PubMed:10606657).Curated1
Sequence conflicti476A → R in AAF26712 (PubMed:10606657).Curated1
Sequence conflicti497S → R in CAB53100 (Ref. 2) Curated1
Sequence conflicti514P → S in CAB53100 (Ref. 2) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03036414L → P1 PublicationCorresponds to variant dbSNP:rs3735165Ensembl.1
Natural variantiVAR_05273049G → R. Corresponds to variant dbSNP:rs35090619Ensembl.1
Natural variantiVAR_03036588P → S1 PublicationCorresponds to variant dbSNP:rs11553624Ensembl.1
Natural variantiVAR_03036692R → H. Corresponds to variant dbSNP:rs17173702Ensembl.1
Natural variantiVAR_03036797A → V. Corresponds to variant dbSNP:rs17173703Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0540691M → MGIGVSLLLQFSLTPGGYRS VGRSRRCSRGSIPRNIPKRS WKKPHPQLCSLQAEEEPM in isoform 2. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF201303 mRNA Translation: AAF26712.1
AJ245553 mRNA Translation: CAB53100.1 Frameshift.
AC005586 Genomic DNA Translation: AAS00385.1
AC005586 Genomic DNA Translation: AAS00386.1 Sequence problems.
CH471173 Genomic DNA Translation: EAW54117.1
CH471173 Genomic DNA Translation: EAW54118.1
CH471173 Genomic DNA Translation: EAW54119.1
BC000363 mRNA Translation: AAH00363.2 Different initiation.
BC001760 mRNA Translation: AAH01760.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43677.1 [Q9BWE0-3]
CCDS47745.1 [Q9BWE0-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001093165.1, NM_001099695.1 [Q9BWE0-4]
NP_001093166.1, NM_001099696.2 [Q9BWE0-3]
NP_037532.2, NM_013400.3 [Q9BWE0-3]
NP_055189.2, NM_014374.3
XP_005250042.1, XM_005249985.1
XP_006716010.1, XM_006715947.3 [Q9BWE0-4]
XP_006716011.1, XM_006715948.3
XP_006716012.1, XM_006715949.3 [Q9BWE0-4]
XP_006716015.1, XM_006715952.2 [Q9BWE0-3]
XP_006716016.1, XM_006715953.2
XP_011514414.1, XM_011516112.1
XP_016867570.1, XM_017012081.1 [Q9BWE0-3]
XP_016867571.1, XM_017012082.1 [Q9BWE0-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.647086
Hs.655734

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000397281; ENSP00000380451; ENSG00000214022 [Q9BWE0-3]
ENST00000425389; ENSP00000388287; ENSG00000214022 [Q9BWE0-3]
ENST00000444957; ENSP00000407714; ENSG00000214022 [Q9BWE0-3]
ENST00000489432; ENSP00000417291; ENSG00000214022 [Q9BWE0-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
29803

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:29803

UCSC genome browser

More...
UCSCi
uc003whc.2 human [Q9BWE0-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF201303 mRNA Translation: AAF26712.1
AJ245553 mRNA Translation: CAB53100.1 Frameshift.
AC005586 Genomic DNA Translation: AAS00385.1
AC005586 Genomic DNA Translation: AAS00386.1 Sequence problems.
CH471173 Genomic DNA Translation: EAW54117.1
CH471173 Genomic DNA Translation: EAW54118.1
CH471173 Genomic DNA Translation: EAW54119.1
BC000363 mRNA Translation: AAH00363.2 Different initiation.
BC001760 mRNA Translation: AAH01760.1
CCDSiCCDS43677.1 [Q9BWE0-3]
CCDS47745.1 [Q9BWE0-4]
RefSeqiNP_001093165.1, NM_001099695.1 [Q9BWE0-4]
NP_001093166.1, NM_001099696.2 [Q9BWE0-3]
NP_037532.2, NM_013400.3 [Q9BWE0-3]
NP_055189.2, NM_014374.3
XP_005250042.1, XM_005249985.1
XP_006716010.1, XM_006715947.3 [Q9BWE0-4]
XP_006716011.1, XM_006715948.3
XP_006716012.1, XM_006715949.3 [Q9BWE0-4]
XP_006716015.1, XM_006715952.2 [Q9BWE0-3]
XP_006716016.1, XM_006715953.2
XP_011514414.1, XM_011516112.1
XP_016867570.1, XM_017012081.1 [Q9BWE0-3]
XP_016867571.1, XM_017012082.1 [Q9BWE0-3]
UniGeneiHs.647086
Hs.655734

3D structure databases

ProteinModelPortaliQ9BWE0
SMRiQ9BWE0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi118927, 40 interactors
IntActiQ9BWE0, 11 interactors
MINTiQ9BWE0
STRINGi9606.ENSP00000417291

PTM databases

iPTMnetiQ9BWE0
PhosphoSitePlusiQ9BWE0

Polymorphism and mutation databases

BioMutaiREPIN1
DMDMi74761300

Proteomic databases

EPDiQ9BWE0
jPOSTiQ9BWE0
MaxQBiQ9BWE0
PaxDbiQ9BWE0
PeptideAtlasiQ9BWE0
PRIDEiQ9BWE0
ProteomicsDBi79270

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
29803
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000397281; ENSP00000380451; ENSG00000214022 [Q9BWE0-3]
ENST00000425389; ENSP00000388287; ENSG00000214022 [Q9BWE0-3]
ENST00000444957; ENSP00000407714; ENSG00000214022 [Q9BWE0-3]
ENST00000489432; ENSP00000417291; ENSG00000214022 [Q9BWE0-4]
GeneIDi29803
KEGGihsa:29803
UCSCiuc003whc.2 human [Q9BWE0-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
29803
EuPathDBiHostDB:ENSG00000214022.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
REPIN1
HGNCiHGNC:17922 REPIN1
HPAiHPA036022
neXtProtiNX_Q9BWE0
OpenTargetsiENSG00000214022
PharmGKBiPA134933473

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00940000162588
HOGENOMiHOG000234617
HOVERGENiHBG018163
InParanoidiQ9BWE0
OMAiECACCGK
OrthoDBi1318335at2759
PhylomeDBiQ9BWE0
TreeFamiTF326846

Enzyme and pathway databases

SignaLinkiQ9BWE0

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
REPIN1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
REPIN1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
29803

Protein Ontology

More...
PROi
PR:Q9BWE0

Gene expression databases

BgeeiENSG00000214022 Expressed in 230 organ(s), highest expression level in skeletal muscle tissue
ExpressionAtlasiQ9BWE0 baseline and differential
GenevisibleiQ9BWE0 HS

Family and domain databases

InterProiView protein in InterPro
IPR039705 REPIN1
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PANTHERiPTHR24406 PTHR24406, 1 hit
PfamiView protein in Pfam
PF00096 zf-C2H2, 10 hits
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 15 hits
SUPFAMiSSF57667 SSF57667, 9 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 14 hits
PS50157 ZINC_FINGER_C2H2_2, 14 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiREPI1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q9BWE0
Secondary accession number(s): C9J3L7
, D3DWZ1, Q7LE03, Q9BUZ6, Q9NZH2, Q9UMP5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: June 1, 2001
Last modified: February 13, 2019
This is version 143 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again